Join devRant
Do all the things like
++ or -- rants, post your own rants, comment on others' rants and build your customized dev avatar
Sign Up
Pipeless API
From the creators of devRant, Pipeless lets you power real-time personalized recommendations and activity feeds using a simple API
Learn More
Search - "well all do it"
-
Oh my god... Storytime.
A customer comes in with I assume is his father or grandfather.
Customer: I need a computer, but without all the internals
Me: So a case?
Customer: Yes, I need a Dell computer outsides, but without the internal components.
Me: Well, we don't have Dell cases, but we sell custom build cases and they come with a power supply.
Customer: *says nothing, but looks interested*
Me: *walks over to the cases to show him* So this is what the cases look like and we have two types, one for a ATX and one for a micro-ATX.
Customer: *still says nothing, but looks at them*
Me: What motherboard do you have at the moment?
Customer: Well, I don't have anything right now, but I'm replacing another computer that didn't work very well. I'm going to be getting some Dell parts to put in here.
Me: O-okay. So this other computer, I'd like to see it in shop to see what's going on with it.
Customer: Oh, you do NOT want to do that. I hooked it up to another computer and it blew it up.
Me: Huh, that's weird. I'd still like to look at it if possible.
Customer: Oh no, it's all wired wrong and... *some bullshit, but stay with me*
Customer: I am the best at technology. My hand has computer parts in it--government funded. *some more bullshit*
Me: Okay... *I try to bring it back around* Well, I'd still like to see the other computer for myself. So you don't have parts for this new build yet, right? You don't know what type of motherboard you have?
Customer: No.
Me: Well, I would get the internals first, so you know what size of case to get, and then get the case.
Customer: Okay. Thank you for your time.
He shook my hand with his "cyborg" hand and I was tempted to say something about "try not to crush my hand," but elected not to. Also during this entire exchange, the old man continuously farted in the background.22 -
So... A random morning moment:
(c - Cient, m - me)
C: Help!!! Our users are complaining that our website is not working as intended!!! This is crucial!!!!
M: What's the problem? What is not working?
C: EVERYTHING!!!! FIX IT!!!!
M: Could you be more specific...?
C: Look at the bugsnag - it has all the errrors!!!
M: *looks there - no errors* - But... It has no errors...
C: Okay, so client told me he's using Galaxy SII - does that ring a bell?
M: *thinks that I'm fucked* - Asks, which browser?
C: Why do you need it? It's a browser after all...
M: Yeah but not all browsers are the same and I need type and version to investigate...
C: It's Samsung default browser... Last updated 2012 January.
M: Well, tell that user to update the browser, the site is working fine on newer versions...
C: No, you update it.
M: Browser?!
C: Yes, what else?!
M: Of course, I'll fly 3000 kilometres to press UPDATE button on clients phone...
C: Well, he's not doing it himself - he's afraid!
M: Well, that is his problem. Site is working fine for other users with newer browsers.
C: But... He's a client
M: I get it but he's a client that uses 6 years old browser and tries to visit our website. Don't you remember that we ditched IE support on your behalf for the same reason?!
C: Oh... I see... Can you make something that it works with 2005 browsers?
M: Of course... *evil laugh starts* I'll make the website work on EVERY single device EVER - make it plain text.
C: Are you joking?
M: Are you?
----
And since then, we ditched the actual need for supporting users with old browsers that don't update to modern standards... Feels great!12 -
Conversation today...
Guy: "Hey I need a real quick script to pull some values out of an XML document...is that possible?"
Me: "Uh...yeah that's pretty simple if that's all it has to do."
Guy: "Ok excellent I'll send you some files and documentation."
Me: "Ok so is this like a one time use thing or do you need to parse multiple of these?"
Guy: "Actually it needs to run all the time, on this specific PC, watch directories for any files that are added, then generate a XLSX files of the values, and also log information to a database. Etc"
Me: "Oh that adds quite a bit of complexity from what you originally said. It's going to take more time."
Guy: "But you said it was easy."
Well fuck you...12 -
Recently had an interview with a company. At some point an SELinux question came up and while I didn't provide the best answer ever (I'm hardly familiar with SELinux and mentioned that as well beforehand so they knew), it was technically correct and the reaction of the interviewers was funny.
TI (technical interviewer): say your php script isn't executed and after a while you find out that SELinux is blocking php script execution, how can you fix that?
Me: setenforce 0...? (essentially disabling SELinux at all)
TI: disabling it entirely for getting php execution to work?! That doesn't sound like a good solu...
HRI (HR (non technical) interviewer, also present): *turns to TI* - but, would it solve the problem?
TI: 😐 well, yes, but... That's a bad thing to do so I wouldn't count is corre..
HRI: *still aiming towards TI* but you simply asked him for a way to solve the php execution issue, would his answer work? Regardless of whether it's the best or worst solution, would it be a solution which works?
TI: well... yes...
HRI: then he answered correctly I'd say, next!
(yes, I'm aware that my answer wasn't good as for security at all but it would have solved that problem which is what was asked)18 -
Prospective client: “I have a website through which I sell music, both physical copies and downloads, but am having all kinds of issues with it”.
Me: “Like what? Tell me more.”
Client: “Go to www... I’ll go through them with you”.
So I go, and client proceeds to rattle off a list of totally random shit for the next 26 and a half minutes without even stopping for breath, telling me what he’d prefer, talking through how easy other “similar” websites are and comparing his own website to them, as well as all the things that flat out just don’t work. He ended with the line “I just paid my developer who told me it was all good, but now he’s telling me he’s too busy to work on it”.
Meanwhile I’ve had a gander at “view source” and can see it’s been “built” with Wordpress, and with a fuck ton of plugins and shit to boot... you can only imagine the sense of euphoria I’m feeling at this point.
Me: “Did you have a contract with your developer?”
Client: “Nah”.
Me: “Do you have a budget in mind, either for just making right or for ongoing development?”
Client: “Yes, but minimal”.
Me: “So what do you want from me?”
Client: “I want to know how much it’s going to cost to fix!!!!” (apparently irritated by my question).
Me: “Oooook... Is there any way I can have access to your website to investigate, or clone it so I can recreate what’s going on?”
Client: “Yes” (gives me details of how to log in to his hosting, and WP admin).
Turns out, he had over 50 active plugins for literally EVERY. SINGLE. FUCKING. PIECE of functionality on his website. Furthermore, it was pretty clear that some plugin functionality overlapped, because... well, if you don’t know how to do something, install a plugin or seven to get it done, right?
Me: “So can I ask, what exactly is your budget? Just to give me ballpark as to how best move forward?”
Client: After going into how he’s already spent a lot of money on it already, “If we could we agree on below £200?”
Me: “...what, a month?”
Client: “No! In total. To make it right. Once it’s done it’s done, surely?!?!”
*a long silence*
Client: “So... what do you think?”
Me: “Burn it. Burn it all down”.8 -
//Long rant
[Boss man]: Hey, we need you to build us a web app.
[Me]: Okay, what do you need it to do?
[Boss man]: We need staff to be able to login from anywhere, create new appointments, check room availability, display live times for the rooms, schedule future appointments, record all the data as stats and export the stats to (email address).
[Me]: Okay, sounds useful, anything else?
[Boss man]: we also need it to send all relevant data to a calendar where certain staff will be notified by email of events.
[Me]: Okay... I'll get right on starting this.
[Boss man]: So you can have it done by the end of the day? (4 hours from this time)
[Me]: *Internal screaming* *WHAT THE FUCK* Uhm, no, I don't think that is possible to complete in a four hour period by myself.
[Boss man]: Okay, well by tomorrow then, I'm leaving for the day though, have a good one.
[Me]....
//End long rant12 -
So today this Mother F**ker get HR to back him up to accuse me of not communicating well in the team because I consistently asked him (the code owner) why he kept coding not following the coding guideline.
How is it not communicating? He literally ghosted me and blocked me every time I ask him questions. Which I somewhat don't understand what he is trying to do. HR lady told me that a senior software engineer should have the knowledge to understand everything and all the code.
But the code looks like this :41 -
Going on a vacation, so notify all clients that I won't be available during two weeks.
Client: well we have this huge presentation and here's a list of stuff we absolutely need for it
Me: sure I have a look.
Me: holy shit dude! That's gona take about 2-3 days. I'm leaving soon!
Client: it's realy critical to have them in a week as it's a very important presentation! Is there any way you can make it work? If we can do anything to help, just name it.
Me: well I'll do my best (planed 1 day for such rhings)
Me: *pulling a 15h day*
Me: here, all done budy! Did a 15h but now it's done, so do that presentation!
Client: oh, nice, but it wasn't that urgent
Me: ...
Next day:
Client ssh in to the server, fucks shit up
Client: well I did a thing and now stage and prod is fucked, can you do anything?
Me: (knowing it will take 30min to fix) well... I try my best. Btw. I'll leave in a few hours and won't take my computer, so try not to fuck every thing again, okay? -
Working with a radio chip we selected because it had built-in encryption. Cannot make the encryption work, thus in contact with the manufacturer:
"- I cannot make the encryption work, it's like the chip doesn't want to take a key.
- which key do you use?
- does it matter?
- well yes, you can't just use any key!
- why not?
- you need to get an approved key from us.
- why is that?
- so that your competitors can't read your data!
- ...
- ...
- so the way to get working keys is to get them from you?
- of course!
- keys are 256 bits. Can we potentially use all of them?
- OF COURSE NOT!
- how many can we get from you?
- one! We reserve it from your company.
- are you telling me that all units within a company will need to have the exact same encryption key?
- yes!
- so anyone with our product could eavesdrop another same product?
- well yes, but it's all within your own products.
- ...
- ...
- that's not how encryption is supposed to work.
- but it's safe, your competitors cannot eavesdrop!
- I'm out of here."
(We finally found a satisfactory work-around, but i am still pissed at them)9 -
Apple has a real problem.
Their hardware has always been overpriced, but at least before it had defenders pointing out that it was at least capable and well made.
I know, I used to be one of them.
Past tense.
They have jumped the shark.
They now make pretentious hipster crap that is massively overpriced and doesn't have the basic features (like hardware ports) to enable you to do your job.
I mean, who needs an ESC key? What is wrong with learning to type CTRL-[ instead? Muscle memory? What's that?
They have gone from "It just works" to "It just doesn't work" in no time at all.
And it is Developers who are most pissed off. A tiny demographic who won't be visible on the financial bottom line until their newly absent software suddenly makes itself known two, three years down the line.
By which time it is too late to do anything.
But hey! Look how thin (and thermally throttled) my new laptop is!19 -
Sister comes into my room
"Can you look at moms laptop, it stopped working I'm scared I broke it"
Ask why
"Idk it just stopped working, all I did was install adobe flash player I dont think that could do it could it?"
Top kek
Take a look
"EFI IPV4 0 (error code) failed to boot"
Weird. Enter bios
"Hard drive: [Not detected]"
Well, that's no bueno
Pop open back, hard drive is loose
Pfft, push that fucker back in
Boot -> works
"Mom is going to kill me I broke it im so worried" -> relieved laughter
Adobeflashplayerkilledmyharddrive.jpg
Shook.exe14 -
Dev: I’m taking a vacation next week
Manager: Good you need a break! I’ve put together a list of tickets for you to action during vacation since you’ll mostly be free during that time
Dev: Do you know what vacation means?
Manager: Well I work during *my* vacation
Dev: You write non-answers to emails and interrupt devs with status questions that are easily answered by a single glance at the kanban board. Also, you’ve just assigned a month’s worth of storyboard points to me on my week long vacation. We’d get more work done if you didn’t “work” during your vacation.
Manager: Well it all needs to get done! It’s the only way we can catch up and get ahead of schedule.
Dev: Why do you exist again?15 -
Had this yesterday on my way back home from the meeting. Bumped into an old study friend who was never fond of Linux even for servers.
"so what do you use at your company?"
"oh uhm yeah uhm right.... Ehh yes ehhhh so uhm like we use like uhm Linux for the servers"
"ah, and? Works well?"
"uhm well uhm yeah ehh yeah works uhm pretty..... Pretty ehhhhhh good 😅. It appears to eh work.... Like uhm very good for servers after all..."
Hearing that coming out of his mouth....
Damn!1 -
Just got this little stinker added to my board this morning….
Ticket Title: Weird shit going on in app
Ticket Description: (blank)
Attachment: <Screenshot of app logo>
Manager: Well what do you think is causing it?
Dev: Causing what?? This ticket doesn’t describe anything at all
Manager: Well it’s a bunch of different things! The ticket is just a high level summary. Now how long do you think it’ll take to fix?
Dev: …16 -
Dev manager: great news guys. We’ve built a new tool to do automated testing on apps. We’ve gotten rid of the old Appium solution we were using and built this new one.
Me: why not just use the inbuilt native stuff? Click to record works really well.
Manager: nah we thought it would be more flexible to build it ourself.
Me: ... ok ... moving on ... how does it work?
Manager: well this new .jar, you download it, pass in a config file, setup up your simulator and appium and the jar will do everything for you.
Me: ... wait you said you hate Appium? Now you’ve built a wrapper around it? And it doesn’t even set everything up, you’ve to do it all by hand?
Manager: oh we had too, would be too much effort to replace it. Don’t worry we can now write all our tests in .yaml config files instead of using Appium.
Me: so we’ve lost the ability of auto-complete and type ahead, everyone has to upskill on a new tool, it offers no new features over what’s available out of the box and we’ll have to deal with new bugs and maintenance and stuff our self ... because we need more flexibility?
Manager: oh don’t worry. The guy who built it is staying here. He’s going to deal with bug fixes and add features. He’s only one guy, but he’s really sharp, it’ll be great for us and the team.
Me: ... ... ...
*audible noise of soul breaking*
Me: ... ok thank you. I’ll look into this new tool3 -
Client: "I need you to implement a feature which does x"
Me: "We can it do like this, I can do it in Y hours."
Client: "Perfect do it"
Me: "Here you go have a look and if you give your ok I'll implement it on production."
Client:"That is not what I need. I need Z"
Me: "Well then you should have said Z and not x. But I can do Z if you want me to."
Client:"Do it it is urgent!!!!111"
Me: "All done here you go."
Client: "That works like what I said what I need, but I meant more like xZ."
Me: "Ok, you know I have to charge you for all this, do you?"
Client: "What why? It isn't the feature I wanted!!11 Do it right and I'll pay you for the right one!"
Me: "It might not be what you wanted but it is exactly what you specified to me. I'll send you the bill and will not continue working for you. Good luck finding someone who is willing to do unpaid work for you."
I am so done with that kind of client.8 -
Employer: so why do you want to join this organization?
Engineer: well like i said in the first 4 interviews, I love desks. Sitting behind them. Standing behind them.
Employer: are you a standing or sitting man?
Engineer: i like to sit in the morning and then switch up to stand at lunch.
Employer: a man with a plan. Very good. Do you remember anything from school?
Engineer: not a goddamn thing.
Employer: perfect. You don't need math. Just emails. You like emails?
Engineer: love emails.
Employer: there's gonna be a lot of emails.
Engineer: can't get enough emails.
Employer: perfect. Do you like a clear separation between life and work?
Engineer: oh not at all. I like it to muddy together in a never ending hell.
Employer: alright and you're familiar with work culture?
Engineer: oh those hours i work for free?
Employer: yes.
Engineer: I love that bullshit.
Employer: alright terrific. And are you familiar with the hate hierarchy?
Engineer: yeah the tech's hate the engineers, the engineers hate the tech's and the managers hate everyb-
Employer: everybody. Perfect. Alright I- honestly I think we'd like to make an offer.
Engineer: well, first I gotta leverage that with my current employer for a raise. And if they don't budge, I'll jump shut.
Employer: no loyalty at all?
Engineer: not at all.
Employer: you're hired.5 -
If the below is you, please stop. I'm starting a revolution called #AnswerTheQuestion
A: Hey, just checked your code, you have a huge security issue in XYZ, you should really address that.
B: Oh god I had no idea, how do I fix it?
A: Well it depends on how you *want* to fix it, no one solution is always the right one.
B: ... Ok, well could you give me some advice?
A: Well, there are many ways to approach this kind of work, but all I can say is that this way, is definitely not the correct one.
B: ... Ok, well how would you do it?
A: That would depend on the customer requirements.
B: ... the requirements is to have a website that isn't easily hackable, what do I do?
A: Nowadays, its pretty hard to make a website completely not hackable.
B: ALL THE SERVERS ARE SHOWING RED, PLEASE HELP ME!!!
A: ........ you really shouldn't prejudge colours. The colour red doesn't always mean danger, depends purely on the use case.9 -
Just discovered that one of my coworkers(well...my boss really) has the uncanny ability to detect fonts and sizes with extreme accuracy.
For some of you that may be not impressive at all and some can probably do it too. But its like...not only on websites man...she can do it on things that we see printed, menus and stuff.
That to me at least is very impressive.11 -
Had a fun little conversation with a potential employer...
Him: We use git for version control. To work with our team you'll be expected to do the same and be proficient at it.
Me: Not a problem. I am well versed with all things git! May I ask, what does your work flow look like?
Him: All of our source lives in a single repo and everyone commits straight to master.
Me: 😐...
Him: Conflicts will not be tolerated.6 -
I have had this conversation well too often:
- (him/her) Do you mind helping me with this problem I have on my computer ?
- (me) Sure, what is it ?
- (him/her) *proceeds to explaining the problem*
- (me) Ok, I don't know about this particular thing, you should try googling it.
- (the pissed off version of him/her) Never mind, I'll find someone who's willing to help me.
Please stop taking that as me not caring about your problem.
Googling things is basically what I do all day as a developer.
You really should try it. That thing is actually pretty useful.5 -
Dev: Hey that internal audit you asked me to perform didn’t go so well
Manager: It has too! I’ll get in a lot of trouble if it doesn’t pass.
Dev: Ok well it’s a lot of work to get it to a passing state, we have to dedicate a lot of resources to fix all these findings.
Manager: We don’t have any spare resources, they are all working on new projects! Why did you have to find things??
Dev: ….It’s a lot of hard to miss stuff, like missing signatures on security clearance forms
Manager: Ok can’t you just say that everything is all good? They’ll probably not double check.
Dev: I’m not really comfortable with that…Look all of these findings are all just from one member of the team consistently not doing their job, can’t you just address that with him and I can make a note on the audit that issues were found but corrective action was made? That’s the whole point of audits.
Manager: You don’t get it, if anything is found on the audit I’ll look bad. We have to cover this up. Plus that’s a really good friend of mine! I can’t do that to him. Ok you know what? You are obviously not the right person for this task, I’ll get someone else to do it. Go back to your regular work, I’m never assigning you audits again.8 -
Today @ 4pm:
New dev: I need help with this issue, i've been stuck on it all day.
Me: ok let's look ...... ok, and did you try google this?
New dev: ... no
Me: ... why?
New dev: well this is clearly my issue, why would I google it? I only google for things I don't know
Me: ... ok ... we'll do you know what this bug is then?
New dev: haha ok, fair point, I'll give that a try. Thanks for the tip.
Seriously, should I be worried? I feel worried13 -
Apparently, part of being a software engineer means knowing how to read minds and do other people's jobs.
While implementing a user story for marketing, we found some associated features that, according to the database, have not been used for years. We tell them this. We do the courtesy of asking, "Hey, is there anything on the site that is utilizing these features? We'd like to clean up the DB."
"We don't know."
Engineering suggests, "Ok, lets turn the feature off, then, and see if anyone complains. It's been years according to the DB."
Marketing gets angry and hostile and says, "That's not the way to do things!"
I don't vocalize, "Well, not knowing how to do your own damned job is not the way to do things."
-
Marketing asks us to integrate a third party feature to the site. We ask, "Ok, what page do you want it on, and what information do you want to collect, and what should it look like?"
"I don't know. You're engineering. You tell us."
We implement it as best we can.
Marketing says, "HEY! This isn't done right! It's missing this and this and this!"
"Did you ask us to implement that? According to the user story, it passes acceptance criteria."
Marketing says, "I thought you would just know that! I didn't know it was a separate thing. Just put it on all the pages, then. You guys really should know the site better."
Engineering gets angry and hostile
-
Marketing says, "We need this removed from the site."
Engineering replies, "We have a GUI for that. Just go to this URL and you can do it yourself."
Marketing replies, "Well, if that's a really complicated thing, can you just run a script against the DB?"
Engineering says, "If we've built a UI for you, we really shouldn't be executing SQL scripts directly against the DB."
Marketing gets angry and hostile.
-
Engineering tries asking nicely.
"Marketing, if you want us to add new stuff to the site, or change stuff, please tell us what it is and where it should go and what the customer experience should be like."
Marketing replies, "We don't know the site that well. We are leaning on you to tell us."
I do not vocalize, all while trying to keep my eyes from bulging out of my head, my face red with rage, "YOU ARE IN CHARGE OF SELLING SHIT ON A WEBSITE THAT YOU KNOW NOTHING ABOUT. YOU ARE ASKING FOR CHANGES TO SOMETHING YOU DON'T EVEN UNDERSTAND. WHAT IS WRONG WITH THIS PICTURE?"
Engineering is angry and hostile.3 -
*project manager + designer are showing new designs*
PM: so, can we get some estimates?
Devs (literally all of us): do we have a mockup for this interaction?
Designer: no.
Devs: What about that one?
Designer: not yet.
Devs: What happens when you click here? Hover there? How does this look if I select that option + this option at the same time? Does it make sense that a user can select *this* option with *that* option? They're kind of mutually exclusive.
PM: Well...
BTW: code freeze is in two weeks...4 -
Winter break is next week and I don't know what to do...
I have an exciting programming project I want to work on!
Buuuut, I also have this 1,500 page book I want to read!
Buuuuuuut, my manuscript still needs some work! I want to work on it as well.
If I do all three, I won't get to finish anything, so only one task during break.
Three of my favorite things... Why must choices be so difficult?
Also, the picture is the 1K page book I bought. :) It's beautiful!28 -
This is my first post. Had an exam in php, xampp wasnt working, assistant came and said i dont know to configure codeigniter, after 30mins of calling he came, tried and sad "well this isn't working". He then called administrator to reinstall xampp. I lost more than half of exam time. I didnt finish it in time, he said that i could do it in a less time by his opinion. It was full working php site with crud and customer view. When xampp started working i had 1h to do it all. After some time and arguing i got a a new date to do it. It is tommorow. Help me god hahhah.11
-
*makes course outline*
Management: Um yeah make the outline similar to this course from earlier
Me: Hmm, so Yocto etc.. well that'll require a good amount of research because I've got no idea what Yocto is or how I'm supposed to use it.
*researches about Yocto, prepares build VM and Raspberry Pi target, thinks of how on Earth I'd make my coworker without Raspberry Pi interface with it from across the world*
2 days later..
Management: Yeah actually we don't want Yocto. Just do simple stuff like application development, GPIO etc.
Me & co-worker: Awesome mate! That'll make things a lot easier. Except for the 2 days of lost work, but we can live with that if it's just GPIO and such.
3 days later..
Management: guys your course outline sucks. Do it all over again, we want Yocto to be in it after all.
YOU MOTHERFUCKERS!!! Why don't you behave a little bit less like a fucking client that doesn't know what they want for once?!!18 -
Well, it happened!
After decades of waiting, it finally happened...
Very early on in my career, I was told that one day, one of your client will ask you to make the logo bigger.
Well, today was that day.
My client didn’t really understand just how much of a negative impact it would have on his site’s navigation by making his always obnoxiously larger ugly icon an additional 10% bigger.
He also failed to understand aspect ratio and forced me to stretch his low/res raster image without scaling it in all 2 dimensions.
He actually used the line from the infamous song “...I don’t want to tel you how to do your job by can you make the logo bigger?”
https://youtube.com/watch/...3 -
Fuck you StackOverflow! Why do you ban people who have a positive score? Shit, I'm raging right now. I have a positive fucking score! It is not because I asked a few questions that were not well received by your fucking elitist overrated frustrated community that I should be banned!
And fuck off I'm not a native english speaker, it is OBVIOUS that I won't be able to make perfect sentence in all contexts.
FUCK FUCK FUCK FUCK21 -
"Can you do this?"
Sure, give me the information I need...
"We don't have all of it yet"
So I can't do it then
"Well when can you do it"
When you get the information
"Do you need *all* of it"
Well, it's either I do half a job and waste my time, or get it all done in one shot
"The client wants it tomorrow"
When will we have the information?
"We don't know"
Well they aren't having it tomorrow then, are they...
Sales people... don't care *how* things work, as long as they get a tick against their name to show they've sold something...3 -
Fuck ever working for a company that doesn't know shit about the worth of a developer ever again.
> be me
> just got my first class masters in Soft Eng that I worked hard as fuck to get
> get a job for a pretty well known medical company here
> offered a bit less than what I was expecting but fuck it, it's a job straight out of uni doing what I want to do
> fuckitwhynot.mp4
> stay for a year with no bonus programme, no pay review, no objectives, no perks, literally fuck all
> see literally every other position in the company be promoted and actually supported from IT & the developers
> feelsBoomerMan.jpg
> get the hail mary recruiter "you'd be great for this role" linked in DM
> follow it through and go to the interview
> nailed it
> comes to negotiating a starting salary and they actually laugh at my current rate and immediately raise it by about 30% with bonuses, reviews and all that shit occurring regularly
> later virgins5 -
My boss gave me a project without any meaningful requirements and asked:
boss: can you finish this in 9 months?
me: well I really can't give you any estimate.
boss: well just do it.
8 months later I summarize all weekly requirements that the client has given and estimated I should be able to finish the project with just 3 months, if only the requirements are ready and not changing from time to time. What a f***ing waste of my time? Why the f*** people do this? And after all this my boss said:
boss: I think we should be able to finish this project faster.
YOU THINK!4 -
Second day on the job, only one with no real degree in software development (did much stuff in free time, just finished school, got the job mainly because i knew people there)
So you can imagine that they were sceptic about me.
Chief executive whatever told me there is a problem with some JavaScript they can't fix cus there is no time and shit for that.
I was like ALL IN and said i could do this in a few mins.
Fixed it in 20 mins. Everyone was cheering. I was like "Well it was the right decision to not do my homework back in the days.." 😁1 -
Okay so even at my advance 52 years of age, I still pull all nighters to handle emergency remediation projects, and clean up other peoples messes. I don't mind, I'm a geek, I get high on the challenge of fixing shit that is broken all to hell.
But tonight was different. Tonight has me raging.
I am tasked with renovating a website, and building a sister site to that main site as well. no bother, I haven't done any web dev in 15 years but I'll power through pulling 18 to 20 hours a day for a couple of weeks to get in the groove...
Little did I know... CSS is a pain in the ass to be sure, but FLEXBOX is total and complete bullshit.
I don't give to shits about all the fancy shit it can do, it can't do simple shit worth a damn. Fuck Flexbox, and anyone involved in producing that useless layout model.
The sheer number of idiots promoting that hunk of shit a solution that is to be applied to any task other than wiping my ass is astounding.
Fuck all you jerk offs out there posting your shitty mark up turds as if they are gold, when you know better than anyone it works, sometimes, then doesn't, and is so easy to break it may as well be called "Web Design Jenga".
I'm still tired as hell, and tomorrow I will go back to slogging through CSS as the layout method, but at least I feel a little better now.
Oh and before I forget FUCK YOU FLEXBOX you piece of shit.14 -
Boss: We need health data for this iOS app.
Me: Cool, so we'll use apples HealthKit.
Boss: No that requires the user agrees to it.
Me: ... well yeah ... its private data.
Boss: No we need it to work regardless. If the user says no to HealthKit, just give them textfields for all the metrics HealthKit has and they can enter manually.
Me: .... but ... eh ....
Boss: and we'll partner with some companies and support their devices.
Me: ... see, the thing is ...
Boss: We also need to store it locally and then sync it to the cloud app. What do you think?
Me: ... ... ... no2 -
Trying to setup server monitoring for one server (will deploy it on all my servers once this works well).
Getting these email notifs to work is a bitch 😅
(can't do pushover etc since those require GCM and I've got Google blocked out of my phone)20 -
Tech support: we need to install backup software on your laptops.
Devs: what for?
TS: to backup all your important files, like word docs, excels, etc.
Devs: we don't use those. everything is on git/confluence/etc
TS: my boss told me to install it everywhere, so I have to do it.
Devs: well just disable it. uses too much tam, disk time and such
TS: whatever.
So he installed it on each laptop separately, took half a day, then we just disabled it and proceeded with our tasks. Now we get a question every other week why nothing is being synced from our computers. "We paid for the system and we want you to use it".
yeah..7 -
Weekend projects are fun! Although front end is still a challenge, it looks good enough.
Suddenly got the idea to do something with letsencrypt/nginx wildcard subdomains (*.example.com) so created a project around that now through which you can check what your ip address/user agent/operating system/ip version is (maybe more to come) but due to the wildcard part you can enter quite a number of subdomains which all show the related info.
I'd find it very useful myself, not sure if other people would but oh well!2 -
Funny how it's the conversation when I give my 2 weeks notice that all this comes up, like:
1) how they were "talking about giving me a raise"
2) how they were "hiring more people" so I could spend more time coding and less time doing bullshit
3) how they were going to fix all the other broken things in the company
How do you think it would fly if instead they fired me and I promised to fix everything that's wrong about my working there after the fact?
Anyway, I knew they would pull this bullshit so it was expected. Excited that I signed the new offer today. Finally getting market rate pay and expecting better work environment as well. 🐶3 -
Me vs a government employee in India...
Me: You should have setup net banking on your website. I had to travel 20 miles to get to your office to make a payment.
Employee: Sir, we do have net banking enabled.
Me: I searched all over your website but couldn't find it.
Employee: Oh! Well, I guess it stopped working since it rained yesterday.4 -
Hello "friend", whom I haven't seen or talked to in years. How have you been? Please don't mind me, my life is boring as shit and nothing happened to me since. Yes, I'd gladly make an app for your company because you agreed to do it but apparently you lack the skills. Oh, you've been fucking around for a month doing nothing? That's sad but sure, I can do it by Sunday, I don't have plans for the weekend anyway. You say you can't pay me more than what I earn in six hours doing my day job? And your boss should think you did it all by yourself? Well, let me consider this cool little opportunity. I'll be in touch, talk to you "soon"!1
-
It's only day one of the year and I'm already pissed right off
Why the fuck do all clients expect you to come up with absolutely everything!?
All I ever get is we want a website. I ask well what do you want on it.. our products .. news? Contact maybe ... Urm our business information ... That kind of stuff.
Well what are they?
Pft.. I here is a name if our products. And other stuff
WE ARE SELLING IT WAT ARE THE PRICES AND INFORMATION DO YOU HAVE IMAGES
Yeah do you want them
Of course I do 😐
Great here's 2 of them we have 1100 so I'll get more to you soon.
😤 Thank you!
Holy shit it's always like talking to a fucking brick wall.. why do people have to make our jobs so hard it's already fucking tough
I have no time to plan your entire website by myself I don't know what you want on it. How could I possibly know that!? It's your fucking site10 -
My friend who is new to Android App Dev was trying to make a simple app that programmatically takes a pic then sends it as an MMS. He opened Stack Overflow, copied code and i heard him murmur "hmm this is simple". Knowing the future, and the wrath of Android Studio, i leaned into my seat and waited. 2 hours later i knew Andy Studio had pissed all over him and it was written all over his face. I walked past him as if to go to the toilet then back again, his screen was blood red with errors and my heart danced and sang.
3 hours later i was out of the room and he sent me a text saying "I give up". I replied, "well tbh, im suprised it took you that long"
Thank you Android Studio for showing all those who think all we do is copy and paste code that they are freakin retards.4 -
PM: Can we have it so the usernames are case-sensitive?
Me: uhh, sure I guess.. But thats like really pointless and adds no real usefulness.. In fact makes the whole logging in thing a tad more complicated for no reason..
PM: Well this one other product we have uses "Admin" for the login versus yours that used "admin" so it needs to be implemented.
(note that mine accepted "Admin" anyways...) *implemented it*
PM: So there's a problem with the username sort, it sorts by capitals then lowercase.. eg:
alpha
beta
Alpha
Me: Yeah, you asked for case-sensitive usernames..
PM: Well can you fix it?
Me: I could create a second field within the user data that is the username in all lowercase and sort by that. But that negates like all of the whole case-sensitive usernames thing.. OR I could drop all this actually important work I'm doing and do a whole bunch of work on a custom sort for this useless fucking feature you wanted me to put in..
*it's been 2 weeks and still no reply...* -
Tl;Dr: Client-side validated online test
Some stupid questions in an online test.
Not all of them were coding questions, but all (yes ALL) were client-side validated and to solve the tasks all I had to do was to copy one array into another and set the time I needed for that task to a legit number.
Well at least it was an online test that doesn't required 3hours.2 -
Typical conversation between my parents and me
Parents: Can you make stuff?
Me: Make what?
Parents: The thing you do all the time.
Me: "Computer stuff"?
Parents. Yah...
Me: Well, yes, why?
Parents: What can you do?
Me: Well, I know C# the most...
Parents: Can you then make software like Facebook, Twitter, etc?
Me: Well, I can, but that will take a lot of time.
Parents: You should really make something and make money.
Me: Ok. (goes into my room, and turns on laptop)
(a few monents later....)
--[[CHORUS START]]--
Parents: U DOIN COMPUTER???
Me: Uh-huh.
Parents: When did I said to do "Computer stuff"?
Me: Well, you said to rest.
Parents: But I never said to do your "Computer stuff"!
Me: But you said to rest. For an hour!
Parents: WHY U SHOUT AT ME!!!! TURN OFF THAT **** NOW!
Me: Ok.... (turns off and opens C# book immediately)
Parents: What's that?
Me: C# book
Parents: What's C#?
Me: Programming language.
Parents: Where can you use it?
Me: Make stuff.
Parents: Like what?
Me: (lists my personal projects)
Parents: Show me.
Me: (turns on the computer and shows one of it)
Parents: Good. (leaves)
--[[CHORUS END]]--
Me: (deep breath) Can I FINALLY use the computer?
--[[CHOURS]]--undefined coding when can i get the time first world problems money does not fall from the sky parents conversation9 -
Mid-Friday: Boss: Start programming this application.
Me: Cool, how will it be setup? what lang-
Boss: Everything's already setup, just start programming in PHP. Check in and make sure it's done by Wednesday morning before 9.
Mid-Tuesday:
Me: Cool, it's done. Had some trouble with connecting our database to the clients, some permissions were conflicting.
Boss: Now I need you to pull it, publish it to our other azure portal, change it to ASP.NET Core 2.1 MVC and install it to teams. Also change the database to MySQL.
Me: I thought everything was already setup.
Boss: things change.
Me: Cool.
*Pulls an all nighter*
Me: Something isn't right...
Wednesday
Me*hasn't slept yet*: It's done.
Boss: Why do you look so tired?
Me: I was working last night
Boss: Well you shouldn't do that.
Me: The deadline is today. only way it was going to get done before 9 was to do it last night.
Boss: Doesn't matter.
9am Meeting:
Boss: it was easy, no hassle, it's up and running.
Me: no hassle?7 -
Job Interview for a CTO role for a premium employer, a big law firm.
All is going well, I am telling them about my years of experience doing complex software integrations in business environments. Talking CRM/ERP, project management and development with external service providers. I tell them I want a salary of 100k and they nod in silence.
Then out of the blue one of the three stakeholders/managers leans over for a final question:
"Soo, we have this really big IT problem and if you would happen to know a solution to it, you would really prove your worth: I have these 10k+ E-Mails in my Outlook folder which doubles as an archive and Outlook keeps getting slower all the time. What can we do?"6 -
I saw a quote maybe 2 weeks after I signed up in this Heaven, I can't (read "I'm too lazy to") find the quote but some guy was lowkey panicking about the fact that all his friends were "currently building X, almost finishing to dev Y", while all he ever did was a small project like "yeeey, I can do something with my 10 fingers"
This rant was interesting, but the top comment kind of marked me, if I remember well, it said something like "All I read is 'doing' and 'almost finished', while you 'did'. I would trust you over these guys".
From this day, while I worked on two side projects, there was always a moment where I thought about this sentence.
Today, I finished one of my side projects. I DID it.
Dang it I feel complete.3 -
TL;DR age != competence
My boss is a fucking computer illiterate self taught programmer.
Don't get me wrong, he can do shit, pretty shitty but it gets done...
But the dude has 38 fucking years old and somehow still searches for keys on the fucking keyboard and struggles to touch type anything...
I sometimes crying the fuck out when I have to help him with something...
I'm having a mini fucking panic attack right now just thinking of it... Fuck
He is our "manager" but doesn't even have the fucking balls to confront his own subordinates when they need to be confronted... Everyone is aware of this and everyone is fucking around... And no one sees any consequences... I wonder why deadlines are always missed...
He is so passive that every fucking thing someone asks he goes and says it is OK...
I was studying same psychology about ignorance and I think he lacks the understanding that shit is hard to do...
We literary had a conversation the other day something like that:
Boss: so, what do you think? One call to the api for it to return all data or multiple calls to return smaller ones?
Me: well... It takes ~180ms just for latency to the server for one call, if you have 10 calls it will take 180*10ms, it is better if we have one call and cache it if necessary on the backend.
( he has no fucking clue wtf caching is, besides browser cache)
Boss: (looking confuse AS FUCK!!) Well, I don't get it... Maybe I'll test it later.
Me thinking: test how you dumb motherfucker? On you fucking workstation with no fucking latency?
There is no fucking test. I'm stating it. IT IS A FUCKING FACT!
Me: well, it takes that for the call to go to the api and come back , its simple math. 1 == 180, 10 == 1800.
Suit yourself.7 -
Time to rant about JavaScript tutorials.
If you don't know the 'jQuery basic arithmetic' joke, Google it now. It'll make you laugh, promised.
In that manner i just remembered a JavaScript tutorial my fiancee tried to follow when she did an internship at the company i work for last year.
She was tasked to create a temperature interface for our server rack, which she wanted to do via an Arduino and a webserver aswell as an SQL database.
The Arduino part wasn't really a problem, but since she had no experience with js she very closely clinged to a chart visualisation tutorial.
All of that worked very well, but beeing the person i am i looked at the code and found something off.
The chart library had no dependencies to external libraries or any local files for any of them. Though the tutorial used a jQuery import.
So why did it use jQuery?
Well...
To load the chart initialization after the page has loaded.
So they pulled the entirety of jQuery in just to do what fucking window.addEventListener('DOMContentLoaded',function(){...}); could have done.
I wonder how many people who just want something to work did this shit. I hate it that so many tutorials do not adhere any kinds of standards, override behavior because they don't like it, even though it may have a very good reason to exist, pull entire libraries in for something vanilla <language> can do in 3 lines, etc.
Fuck.7 -
Well, I guess all the Linux folks are going to know what I am talking about. Do you know this feeling (Yes, you know. Don't tell me anything.) when you use Linux and nobody else uses Linux in your Work/School. And these people come to you and say.
Stupid people : Oh! You use Linux. That's bullshit!
Me : No it's not. It doesn't do 24/7 updates like Windows.
Stupid people : No, Linux is bullshit you don't have money for Windows. And Linux can't run professional Applications.
Unfortunately there is no medicine that cures dumbness. Just saying ...
I'd rather stay not dumb like these people instead of buying another Windows license.24 -
I dont hate PHP, but I do hate when lazy admins do stupid things.
Why can't the PHP-maintainers do a proper website? Why the fuck can't I subscribe to mailing lists?
Well, it seems like when I do a request, the webserver sends a email with MY EMAIL. And guess what, the listserver REJECTS it because it fails DMARC.
They also refer to the manpage of ezman, but they have disable ALL the functions there too.
What kind of retards is doing that shit. I completely understand why people hate on PHP now.6 -
Just stumbled upon this channel of a woman called Jeri Ellsworth.. turns out that she's interested in HAM radio. This is something that I'm personally interested in as well, and seeing how the community here seems to have a keen interest in electronics, I figured that I might want to put it out there. After all, knowledge is to be shared :)
Also she's apparently self-taught as well which I think is really impressive. That's what - to me at least - separates the "I do it just for the money" people from the genuinely interested ones, and the spoonfed bunch from the curious few.
https://youtube.com/channel/...8 -
Just got a warning email from OneDrive saying my account would be frozen soon because I had used 28.1Gb of my alotted 5Gb...
Erm... First off, I do not use OneDrive. I use Google Drive and JottaCloud. I have actively tried to get RID of OneDrive in Win10, with all those damn notifications all the time.
Secondly, I guess it's nice that if you DO use OD and hit the limit, they don't just cut you off instantly. But nearly 500% overuse seems a little late to react, no?
So I logged in and looked around to find out what the hell was in there. Turns out, MS had decided to upload my entire images folder. I did not ask them to do that. Deleted them, but will have to check the damn OD service when I get home so I can KILL IT!
And I am going to have (yet another) talk with MS support as well, I think...7 -
Fuck (some of) you backend developers who think regurgitating JSON makes for a good API.
"It's all in JSON. iOS can read JSON, right?"
A well-trained simian can read JSON, still doesn't mean it can do something with it. Your shitty API could be spitting out fucking ancient Egyptian for all I care, just make it be the same ancient Egyptian everywhere!
Don't create one endpoint that spits out the URL for the next endpoint (completely different domain, completely different path structure). Are you fucking kidding me?
As if that wasn't enough, endpoints receive data structured in one way, but return results in another!! "It's all JSON", but it's still dong.
How do I abstract that, you piece of shit? Now I have to write ever so slightly different code in multiple places instead of writing it only once.
How the fuck do I even model that in a database?
Have a crash course on implementing APIs on the client side and only come back when you're done.
Morons.6 -
Backstory: Offering manager brings a project through a few months of requirements gathering / feasibility study etc. Project spends 8 months with a R&D team to flesh out. Our team gets 6 months to turn it into a ship able product. 4 months in, offering manager calls a meeting.
OM: ok so you are all working on project X, well I need your input on something
Team: Ok, go ahead
OM: what do you think the app needs to do?
Team: ... I'm sorry?
OM: well we've been looking at it, and we don't think it does very much compared to existing apps. We need a killer feature but we don't know what. Any ideas?
Team: well we were looking at project Y originally, which was a lot more advanced. But you pulled the plug in favour of this.
OM: yeah, believe me customers will want project X a lot more. It just needs to do something interesting ... you know what I mean?
Team: not really, if it doesn't have anything, why did we go for it?
OM: ok I don't think I'm being clear. Point is, if anyone has any ideas let me know, we need to ship it in 2 months and it needs to be killer
I handed in my notice that week and was asked why ... let's just say I told them. -
Manager: "Hi Almond, how is X going?"
Almond: "...I don't know, Bob is in charge of that."
Manager: "Ok. Do you know the status of Y at all?"
Almond: "Not sure, isn't that Bob's responsibility too?"
Manager: "Well, yeah, but I never seem to be able to get a good answer out of him. Find out on both fronts and let me know ASAP please"
...sure, I know how this goes. I'll stop all the dev work I'm doing, do your job for you, talk to the lazy bonehead that never bothers doing anything, report back that he's done sod all (or still "in a requirements gathering phase" as he puts it), be asked "why is he taking so long", have a bit more back and forth, then decide we'll just leave him be as actually trying to get him to do any work is going to be too much like hassle 😒6 -
Me : *trying to download latest version of android studio*
Google: "Your client does not have permission to get URL /studio/index.html from this server. That’s all we know."
Me: FUCK YOU GOOGLE
Me: *googles: دانلود اندروید استودیو* (which means download android studio)
*and downloads it from a random website*
It happens every goddamn time, why the fuck i can't download this shit !? Because these countries are fighting each other all the time! What did i do wrong in my life? I just want to download your fucking app to write another shitty app to continue my fucking life. I don't know shit about this wars happening, I'm just a dev like others all over the world.
Downloading an app, is that too much to ask? Well fuck you then.14 -
Well, the system is offline, links are broken and users are complaining! Developer, what did you do?
After some digging around the designer made a "simple change" to a csv file, add a column to include the image file name of each item...
I mean, it just shifted ALL THE COLUMNS in a csv file but what could go wrong? 🤦♂️2 -
Isn't it disturbing that all major operating systems disrespect the computer's ability to do things? Everyone is becoming a walled garden, and people are increasingly developing and limited languages that consume more resources than they deliver value. Today VisualStudio on a corei7 is less performant than a Delphi 5 running on a Pentium 166mhz.
Much of its processing, energy and carbon emissions are used to display ads that "interest you".
Well, thank you *BSDs, Linux (except Ubuntu) and Illumos, for continuing to respect my computer's capabilities.7 -
IntelliJ has this tutorial where it teaches you a bunch of shortcuts for making life easy, since version 2017.3 or something like that. Most of it is pretty meh, some of it is pretty useful. And I just came across a keybind to auto format code.
What else do I need. If I can quickly format my code and make it look pretty, that's all I'd want.
"Try reformatting the selected code with Ctrl+Alt+L"
*Linux Mint goes to lock screen*
*logs back in, code is unchanged*
Well played...6 -
Well, it finally happened.
After 25 years coding in all types of languages and environments, I’m no longer having fun.
It now seems like it’s a fight to get interested in the code. I used to be something that I would spend hours / days doing. Now I just want to walk away from the code.
Is it true (do you think) that after a while all you see is a for loop, an if statement, a null check and you just think to yourself. Fuck this! Because I think I’m there.
God it’s depressing to think that I no longer find it fun.4 -
In my first year of college right now, and on the first test we had to write some C# ConsoleApplications. We got instructions of what we have to taken as input, what we had to do with it and output it to the console.
I've tested them all and they all work correctly, which was the main objective. I have used the correct data structures, but I didn't get top mark. Instead, I got lower because "I didn't do it her way".
WELL F*CK YOU TOO!!! I hope this is not how every test/exam goes6 -
I do own a HI-end XPS 13 w/ i7. I have it for more than 3 years by now. It's a fucking beast! It's running cold, VERY snappy, does its job VERY well and VERY fast. I cannot imagine owning a faster machine...
Today I've noticed that all the 3 years I've been running in powersave mode (cpu capped at 1.7 GHz).
Jesus hugging Christ!13 -
Well I met my wife and decided my current profession wasn't going to give us the life I wanted for us. So since I did IT communications in the Army, I decided to look into that field, buy I knew I didn't want to do networking; I hated it in the Army. I read about programming I saw that I could learn some for free online before I chose that as a career. I did the website courses on Codacademy and thought it was a lot of fun! So I enrolled in It's software program, got 1 quarter away from an AAS in software development, then while I was on my honeymoon, they shut all the schools down and filed bankruptcy. Now I've started all over and community college to eventually get a BA in computer science.5
-
Microsoft Teams can burn.
Their latest feature ? Well, turns out that when I get notifications on mobile that I do not get on desktop BECAUSE I AM FUCKING INTERACTING WITH THE CHAT OR CHANNEL THAT SENDS ME MOBILE NOTIFICATION, the notifications do not clear themselves. Oh, no, that would be too smart.
So EACH FUCKING EVENING I sit and browse all the fucking notifications to see if there is anything noteworthy I need to act on, or if it is a dead notification from earlier today.
Dear Lord, Microsoft are fucking experts at TAKE A WORKING FEATURE AND BRAKE IT.14 -
Well two days ago, i was in a sap codin g camp (ranted about that)
The challenge: moke a robot that avoid collisions and 6inds a black mm spot on tha floor
We marginally had enough time te implement sth but well i tried to do an algo.
10 mins before deadline i realized that it wouldnt work. So i took an old prototype (without algo) from the trash bin, fixed compilation errors and went to the competition without testing. Because we had to do a little explanation for the parents about arduinos, we all were shaky. A friend of mine even failed to remember his text xD
Asso, because of Fortuna wanting to beat us down, we were the last team driving in the arena. Everybody got pretty fast times. (with a random algo). At the end, we took our robot with the untestet thrash bin program.
It drove pretty well, avoided collisions and then it happened: it reached (only robot not to collide) the black spot in 1:09!!! 😁7 -
Now that I am coding for money, the motivation to learn and build new things is gone. It has become all about money for me now. I get tired after coding all day and I can’t open my personal laptop to learn new things and do some more.. well.. coding.
Will I ever get that motivation back? Because I have some good ideas in my mind. Just can’t seem to start working on those ideas.8 -
A coworker and me did together a "hackathon by choice" this week to finish a project. We did it only because we thought it would be cool and be able to finish the thing. Well it was surprisingly fun to stay awake 36 hours, coding all through, having a good flow. After that, our boss came and was very proud of our work and he was able to send it for inspection to the client. I stayed a bit longer to fix a few minor bugs, but after 42h I was finally in bed. 😁
Our boss gives us the following Monday off.
But I think on other projects, often deadlines take the fun out of it, if they are not estimated well... I mean you do great, high-professional work but in the end you feel bad, useless, slow and incompetent because of the pressure.2 -
Well that's indeed kinda funny
But I'd really like to know if it all had to do with Google Cloud Networking, because they had a failure of their systems in us-east1 for 25 hours and it fits the time in some way (https://status.cloud.google.com/inc...).2 -
Just joined a new team at the organisation as senior dev.
Team lead keeps singing about how we need unit testing and good standards.
I implement domain pattern on the backend supported by unit tests.
It passes QA and then get an earful about the code not being 'restful'. What does that even mean?
Well, it matters not since team lead changes the whole feature in the release branch and all unit tests obviously fails. Builds start to fail.
The solution? Comment out all unit tests. In the sprint retro, we hear the same old adage 'we need 80% code coverage'
Do as i say, not as I do. FML.6 -
!rant
Got an interview for a really cool position, don’t have specific knowledge about what they do, though. But willing to learn all of that beautiful stuff..
If I get the position, I will rock it:)
Wish me luck.
If you do, may your code always compile and your server stay up.
If you don’t, well yeah, whatever..4 -
Today after working 7 days on a project. My coworker comes up to me and says he pushed everything on the server and that he cleared git to make everything cleaner. When he did I that he forgot to change some vital things. Now we have a black website running and no backup code. I was so passed at him. Luckily a stressbal works really well. I threw it at is head and felt immediately better. Sad part need to do it all over again.3
-
This is a followup to my earlier RealTek networking rant.
After reviewing and researching all of the wlan adapter suggestions on that rant, as well as a few more, I settled on an Alfa AWUS036ACH usb3 wireless-ac adapter. Every Alfa I've ever owned has been amazing, so I happily bought it.
It arrived today, and I excitedly threw my existing RealTek garbage across the room, hooked up my fancy new toy, and... nothing.
Fearing it was doa, I ran `lsusb` to see if it was even showing up... and it was! but identifying itself as a RealTek device...?
All of my research showed it uses the Atheros9k chipset. It's advertised and praised as using the "famous Atheros AR9271 chipset" and the Ath9k drivers. Except this particular unit appears to use the RTL8821AU chipset, therefore requiring RealTek drivers. askfja;sldf.
I unhappily fetched the garbage from the dirty laundry where it landed, installed it, and began my research anew.
I found, among all of the wonderful promises of Ath9k bliss, a thread on the Kali forums corroborating the RealTek driver nonsense, and it explained how to get the RTL8821 drivers working with it. which is pretty much the very last thing I want to do.
If you've read any of my networking rants, well, they've all been about how totally awful RealTek linux drivers are, and that's pretty much common knowledge anyway. So I'm like extremely pissed off.
ARGH WHY IS NETWORKING WITH LINUX ALWAYS SO FREAKING DIFFICULT? haslkfjasgdskg6 -
Well thanks to all the help from you ranters and some of my close friends, I decided to take the Web developer job. I start in two weeks as a Web Developer!
P.S. PHP is not as bad as I thought it would be. It actually allows me to do as much if not more than C# in ASP.NET land.4 -
Well in America, developer is the current "hot" career if you wanna make bank and rightly so, you can make a great salary. However the "business types" politicize the position since it's trendy right now and do all sorts of undesirable things like looking for "10x" or "rockstar" devs, etc. It's really just an excuse to have you on call 24/7. Some jobs, you go home, but you never really clock out of work. Well, if you even make it home; you could end up always travelling for your work.
But at least it's a romanticized and well paid position, unlike system admin, who may work the same hours but will never have the "cool" job.7 -
(From a previous rant I made)
As a note to all of my brothers from India. I am not happy with the current state in which your country is in regards to this bothersome pandemic. I do not feel happy, I am not jumping around singing to the doom you are all facing. I am sad. I know your people are good and your engineers outstanding.
Were it for me you would all be here in the U.S with me chilling with some good bourbon in celebration to how strong you can make our tech be.
My previous post was in regards to scammers, and I am very well aware that you are not at fault.
Be strong brothers, you will all survive this, just as India has survived generations of struggles.5 -
Well I'm a first year student in computer science and in the first semester we started to learn C language and the IDE they told us to use for better learning was Devcpp.
We made a few small projects and all went well, but now in the second semester we started to make bigger projects with linked lists and memory allocation and Devcpp starts to be a complete bug itself... We are working hard in the project and after saving the project with no errors at all, at the next day, Devcpp starts to make any function we made invalid...
So we spoke to the same teacher about this and asked what can we do about it....
"Are you using Devcpp? You shouldn't, it is not that good for C"...
ARE YOU KIDDING ME?14 -
Building my own router was a great idea. It solved almost all of my problems.
Almost.
Just recently have I started to build a GL CI pipeline for my project. >100 jobs for each commit - quite a bundle. Naturally, I have used up all my free runners' time after a few commits, so I had to build myself a runner. "My old i7 should do well" - I thought to myself and deployed the GL runner on my local k8s cluster.
And my router is my k8s master.
And this is the ping to my router (via wifi) every time after I push to GL :)
DAMN IT!
P.S. at least I have Noctua all over that PC - I can't hear a sound out of it while all the CPUs are at 100%12 -
I use a library and it gives me some strange error message. No problemo, just file an issue on GitHub asking the maintainer if I'm plain stupid or the lib actually has a flaw. As it was a question, I have not posted a dump and all the shit.
Maintainer responds with a snarky comment about his crystal ball being broken and I have to submit a log, a dump, debug information and a bunch of other stuff.
Well, what choice do I have, I collect all the requested information, create a wall of text comment, all nicely formatted.
And the issue ends here. Myths say, the maintainer got asked to join Elvis on Mars.
I mean, why do you ask all the shit from me in a unprofessional manner just to stop answering? Just say "I have no clue why it behaves like this" and I know whats playin. But that's just ... sad.5 -
I know we have a lot of talented people here. Piece of advice, what ever you build, believe in it. See it through. No matter how good of an idea incompleteness won't get you anywhere.
After all every other day we all analyze different successful products and say "huh... that's nothing. Even we can do that".
Well thats the difference "We" can do that, they DID it.
See your ideas through. Stay motivated =)1 -
There was an android project that I got from my senior.
he told me that another developer already completed most the project and all I have to do is minor changes...
Well when i saw, i was amazed that the code he commented is more than the actual working code without any structure.
He copied most of code from internet.
If it's not working, put in comment else use it.
It took me a whole month to figure out what's going on.
And another 2 months to fix the issues.
Well in last my senior told me that the developer took 1 year to write this code
(to be honest any normal developer can complete that project in less than 3 month)2 -
You do know that "why do I need you if I can copy-paste code from SO?" joke floating around, right? Today I had a real-life situation perfectly illustrating it.
So I bought a set of parking sensors. Cheap ones, from AliExpress. Prolly the cheapest ones I could find. Installed them w/ engine turned off. All seemed fine. Cleaned it all up, got ready to go, started the engine and beeeep beeep beeepeeeeep beepp ..... beeeeeeeeep.
fuck.
Tried unplugging/replugging them one-by-one to find the faulty one. Nada. Apparently they all were false-alarming. They must all be bad, bcz they seem to work well w/ engine turned off (ignition on) and only false-alarm when engine is on.
Allright, I'll get a new set next weekend, a more expensive one and replace them again.
There goes my €20 and another week basically w/o parking sensors (car length is >5 meters, so sensors do help a lot).
Today I spend a few hours removing my rear bumper again, replacint all the sensors, wiring, etc. Tests show promising results - all sensors seem OK even w/ engine on! Close it all up, start a car again and.... beeep bep bep beeep beeee..eeeeppp.
MOTHER FUCK!
Another 30min-hour goes by while looking for a possible culprit. And I found it. The fix could did not take longer than 5 seconds. Apparently a wire feedint the sensors' controller was too close to sensors' wires. All I had to do is to push that wire a lil further from the controller with my index finger.
I could have saved €30, a week of time, half a day of work if I only knew what wire to [literally] poke.
shit...4 -
I really don't get all the Musk fans. I mean, sure you can find some value in Tesla or SpaceX, sure you can think theses companies are truly innovating. But why give all the credit to the rich businessman who seems to spent more time promoting himself than really working on science stuff, and not to all the ingeneers and creatives who are really putting some hard work on every day ? All Musk is really doing is running a business. He seems to do that pretty well, agreed, but after all it's "just" that: business. He's not the genius, nor the creative. He has money and invests it well, that's all.
I don't get why so many people give all the credit to him, even here on devrant where it should be logical to find more people supporting the real brains behind the tech.
"He has a vision about the future, he's imaginative..."
- Well that's bullshit.
Once again: he has money, a lot, and a certain skill about how to invest it (and about doing some proper marketing too), which companies to buy, etc. That don't make him such a great visionary about the future of the human being, just a great businessman. I'm sure you can find millions of people around the world with better ideas about the future, but they're not in his position. They're not rich, they're not CEOs, they're mostly unknown.
Stop follow the stream by glorifying businessmen just because medias are talking lot about them. Instead, know where the real talent (and work) is. Give credit to Musk employees, not to him.54 -
RANT!
AAAAAAAAHHHHH!!!
BLOODY FUCK TURD BORN FROM THE BACTERIA OF YOUR MOTHER'S POOP, BRAINLESS WHORE
. JUST ONE SECOND OF YOUR NON EXISTENCE WILL CHANGE THE WORLD FOR ME.
Well this is what I would say to my brain deficient friends who think I don't have a life and sit at the computer all day playing GAMES and that I should get away from my computer and learn to PLAY with them in real life
BITCHES DON'T EVEN UNDERSTAND HOW IT IS TO WORK YOURSELF A LIVING, ALL THEY KNOW IS THROW MONEY AND GET THEIR DICKS SUCKED OFF. FUUUUUCCK!! AND DON'T EVEN GET ME STARTED ON THE GAMES PART. ALL THESE PUNY FUCKS CAN DO IS TO POST POUT FACES FILLED WITH DOG FAECES AND CRY ABOUT THEIR LOST LIKES.5 -
So I promised myself some down time this weekend since I usually end up working all night and in a blink my weekend is over. I also declined going out for better 'relaxation'. Here's how it's going so far...
>Gets home. Hmmm what should I do I can do anything! *thinking*
>Pours a stiff whiskey
>Trys watching something as well as playing a game, gets bored of each and abandons them.
>Opens a dev newsletter
>*blinks*
>Realizes I'm elbow deep in some repo... starting to feel inspired.
>Decides to code something "fun"
>Uses "Well as long as I'm not *working*" to justify his addiction.
I'm really not sure what I did for fun before I started coding. It ruined things by being so damn enjoyable and ultimatley many other things became well... less fun.
This is what addiction looks like.2 -
Simple there are four other developers on my team. Yet, I do all of the work.
I'm picky about spesific tasks, so I would rather do THOSE by myself, by we have a Trello board where I've marked the tasks I want to do myself, and everything else is open for grabs.
Some tasks I will asign others (one developer specifically) and days will pass and no code gets touched. So I end up having to take it over. :|
Like, guys, I get it. You have other things to do. But could you atleast *try* and help me without me having to ask? If not, then why did you even sign up? I want to get this out the door so our project doesn't go under and we can make some money. I have other things I would like to do as well, you know. Like take a day off, or spend time with my girlfriend.9 -
Let's share information! Communicate! How do we do it? Via email!
You got question? Send an emai!
You want to share some excel? Send an email!
Not sure who to ask? Send the email to everyone!
Have a 100 message long email thread and then need some help? Send the whole fucking thread to me and just add "what do'ya think?"!
Send some attachment in email and then 2 weeks later refer to it saying "but I sent the file to you!"? Well surely I can remember your special email from the hundreds of email I get every week.
I did complain to the mangers that why the hell do we have these mega-email-threads? Why do you send all the meaningles release notes to the whole company? The anwer is simple: all information needes to be transparent and if you don't need the info, then just don't read the email!
And fuck you, you CEO wanna-be who sends seasonal greetings through his secretary and thinks anyone gives a shit.4 -
(As a freelancer I was asked to do a couple of tasks on legacy code)
Let’s check this code, how bad can it be?
- all of the following: unreadable mess, no auto linting
- tests: some are there cause there’s not enough automation, others are poorly named
- frontend: somehow a genius made a react component for every variable in the store which only passes the variable to the child (wtf)
- backend: death by best practices
- ci/cd: “we have it but it’s broken”
Let’s fucking goooo 😎
Diagnosis: my therapist is getting rich
Chances to not cry tonight: close to zero
At least they pay well 🤷♂️5 -
Just lost my shit with a colleague which went for the Nth time "Oh MaN tHiS sCrIpT sUcKs So BaD".
Dude, I wrote the thing in 5 days, and back when I did I had no experience whatsoever with JS -or with programming at all, for that matter. It was pretty much my first project and I was as green as it can possibly get.
And yet, that script served us well for well over a year and a half without being touched once. It always worked for everything you could possibly want. Shut your mouth or do it yourself, buddy.3 -
Me: *Make a PR*
Seniors: *takes 5 days to review* This must be changed
Me: Okay. *Make changes and PR on same day*
Seniors: *takes another 7 days to review* Oh, you also need to change this
Me: really? Okay. *do the changes*
Seniors: Well, I'm gonna accept it. But maybe you should rework all the integration later.
Me: what.
I'm super tired of this shit.8 -
Why do people mix JS vanilla with framework syntax? That's horrible.
Why do people use jQuery anyways? There's no need at all anymore. It is just dumb JS for dumb devs.
Did that trigger you? - well....7 -
"Let's go to buy Laptop for you. You're going to be Computer Engineer"
after 2 months
" What do you do all day spending on laptop?"
"Programing"
"Well, how's that work?"
"It follows some algorithms to get desired output"
"???, Some important files are accidentally deleted from my usb storage. Can you recover those files?"
😮😣1 -
The best language to learn.
well actually there's no "best" language, only a good programmer.
all languages can be useful, coding for games, coding for apps, for hacking.
don't choose language because people says it's the best language.
choose 4 languages you find them easy to understand, do basic coding in this 4 languages.
after this, compare it and take the one that was most fun to write.
of course language like Python is more easy for non programmer to study.
but some people find C++ more fun and easy to understand from the beginning.
enjoy and if you have a question, comment it.6 -
Got to know about OSMC/Kodi last week. Took out my Raspberry Pi. Setup OSMC over the weekend, did all the cable setup for 4 external hard drives and connected to TV via HDMI. After few configurations, I'm all setup. I'm astonished by all the features it provides. Fetching data from TMDb (I had actually created a javaFX app to do this for my local library just last month), remote control from Android as well Web Browser. Enabled UPnP and now I have my complete media center floating around my house network. It is one of the best open source project I have laid my eyes upon. Wish I could attach more pics.6
-
One of our politicians at the late-night-show
Q: who wrote La Traviata? Giuseppe or Verdi?
A: ummm.. Ammm.. Well.. *confused af*
Q: so do you know it or not?
A: I know it! I know. I know but I won't tell you. *in all the seriousness*
[true story]
somehow reminds me of IT guys who pretend to know everything just to look cool :)4 -
Interviewing is much harder than it was even a few years ago. I go into it knowing I probably won't get the job. It may sound negative but it relieves the pressure. I also make note of what I didn't do well on so I can work on it. Last year I wanted to leave my job so I would go to interviews at lunch and do phone interviews in the parking lot. I was turned down for soo many jobs. Just a couple of years ago I could get a job in one or two interviews. Things have gotten more complicated. It used to be if you knew even a little about a backend language and a little sql you could easily get a job. It has all changed. I think the javascript framework of the month thing has only made it worse.6
-
Central team: No, your team must be doing something wrong. Our pipeline is super-configurable and works for any situation! You just have to read the docs!
Me: Where are the docs?
Central team: Uhh, well, umm... we'll hook you up with a CI/CD coach!
Me: Okay, cool. In the mean time, can you point me at the repo where all the base scripts are?
Central team: Sure, it's here.
Me, some weeks later: Yeah, uhh, the coach can't seem to figure out how to make our Prod deployment work either.
Central team: That's impossible! It's so easy and completely configurable!
Me: Well, okay... but, here's the thing: your pipeline IS pretty "configurable", in the sense that you look for A LOT of variables...
Central team: See! We told you!
Me: ...none of which are actually documented, so they're just about useless to me...
Central team: But, but the coach...
Me: ...couldn't make heads or taisl of it either despite him literally being ON YOUR TEAM...
Central team: Then your project must just be architected wrong!
Me: Well, we're not perfect, so could be...
Central team: Right!
Me: ...but I think it's far more likely that the scripts... you know, the ACTUAL Python scripts the pipeline executes... while it took me DAYS to get through all your levels of abstraction and indirection and, well, BULLSHIT... it turns out they are incredibly NOT flexible. They do one thing, all the time, basically disregarding any flexibility in the pipeline. So, yeah, I'm thinking this is probably one of this "it's you, not me" deals.
Central team: Waaaaahhhhhhhh!!!!!!2 -
Recruiter reaches out to me, he says he saw my LinkedIn and thinks I'd be a great fit.
I say ok and send my resume.
He gets me a phone screen. I do it, I think I do a pretty good job. (I'm able to answer all the questions well, I think I'm onto the coding interview for sure.)
A couple days later I get a generic rejection email.
I'm not sure what happened. They had my resume, I know I did well on the technical questions (I do that kind of thing for my current job all the time.)
No idea why I'm rejected. If it was something about my experience, they could have seen that from my resume. If it was something from my phone screen, I have no idea what it could have been.
Just wanted to rant >:[8 -
About starting your career at a medium-bigger company that's well-established, versus starting at a smaller company.
That's my point of view:
It's always wiser to begin at a company that's more established (you will also be sure that you will get paid on time). I started at a well-established company, and I managed to buy gear, travel, do stuff, and then I realised that I wanna do more, not only live to work 😎.
Smaller companies are kinda risky, think of it, their goal is to reach the level of a well-established company, which is some levels lower than that. On the other hand, if you do well at a smaller company, your next goal will be to work for a bigger company, which will surely be nicer, more professional and will pay better. So you will have managed to et there with all the skills in your pocket already, which will come in handy later!
Bigger companies are excellent if you have a family (wife and kids), they provide stability, that's the most important thing, but I believe that in order to get "settled" in a company like that, you should at least have tried something else first, like doing your own thing or get challenged in more complicated gigs that require you to up your skills.
In the end, it's all sun and fun, with you code editor by your side 😉. I'm interested to see your opinions.1 -
My new co-worker is extremely stressing. I have to give small tasks so he won't forget to do anything. I also have to explain what he has to do in detail, give him the full solution, and show him exactly how he has to do it.
And he has no idea how to use git. He makes a feature branch and pushes all his various, half-finished features into it and makes a pull request.
And then I still have to refactor his crappy code everytime cause he uses variables like $data, $accA, $accB, $accZ and forgets to use the definied color variables in sass.
I literally have to do my work and his as well -_-6 -
i'd rather burn a site to the ground to preserve it in its current state than let it devolve into a place for SJWs to basically outlaw everything because they're special snowflakes. It's about breaking video games, you don't need to say "well you can't use he/she/him/her pronouns ever, you can't acknowledge binary genders, you can't say the word 'retarded' even when referring to the dictionary definition of the word (synonym of regression), you can't send PMs at all because privacy is against God, you can't say/reference God or Christianity because #NotAllReligions"
just fuck off. We break Pokemon games, we don't plot to genocide the white race because all whites are cis racist Nazi cucks like you do goddammit
;-;15 -
Was talking about how I implemented CI/CD in one of our projects as a starting point to others and how it worked by running tests and deploying to the server and one of my colleagues laughed about having to have tests at all, I explained and asked him what was he gonna do that morning, his answer:
"Well, I'm gonna test the system X and fix some bugs"
To what I replied:
"If you have automated tests you could have those tests automatic(?!) and they also help you finding bugs early"
Wtf do ppl have in mind that they prefer remediation over prevention and they end up wasting their time with shit that could be fully automated?2 -
There’s so much we can learn from Gordon Ramsay..
I wish I could swear & insult like he can..
Woman: “who do you think you are? You insulted my friend!”
Gordon: “well if I did then I probably meant it, now get your fat ass back to your table”
“Congratulations, you just got your head out of your own ass. Now piss off”
*Customer wants more spinach*
Gordon: “ ok I’ll make you more spinach *dramatic pause* and push it up your ass”
Or my all time favorite:
“You fucking donkey”14 -
A lot of larger companies seem to be a happy about forcing employees to change their password every three months or so. They do it for security measures so that it is more difficult to break through the system, however most people end up making the worst passwords.
Instead of forcing a very good password on them every year or two maybe, they all end up having passwords like: "Summer16", "Qwer1234", "London15".
I used to work for our national police, and this was the case there as well...7 -
That’s it I’m done with writing documents like Software Product Specifications and Software Requirements Documents and Software Architecture Documents, manuals, data sheets and more in MS word..
I’m doing it all form this point forward in LaTeX... I can stay in my editor, it works beautifully with version control because it’s just text... I can split it amung multiple files.. it looks damn sexy. I can focus on the content rather than being distracted by formatting and spelling issues and the rest of that shit.. ALSO.. it doesn’t crash or get corrupted.. well at-least I’ve never had a text editor crash or corrupt my files.
Idk why I didn’t learn latex sooner and do the switch.6 -
I am so mad, I have no words for how fucking much I hate ever having to work or pass work to other incompetent developers or teams, what a fucking waste of time and resources.
After handing off the frontend - for the client to find some team, that would do it in the short time and budget he needs (multiple developers, more fast, much good), he found a team that seemed to be alright for the job and seemed alright to me too, now maybe a month or two later, the client contacts me, that they fucked something up and if I could talk to them.
The email I then received from them seriously made me speechles, mad and sad, all at same time, I spent multiple upon multiple hours, getting a very good readable documentation up (markdown with TOC, properly rendered headers, bulletpoints, all that shit), with all files, all services used, all credentials, even converted all ssh keys into putty ppk format, in case the developers are using windows and are too dumb to do it themselves, nginx configs, it had seriously everything, even too much to list.
They somehow managed to fuck up the entire server, while attempting to "add ssh keys themselves", EVEN FUCKING THOUGH I have included all the keys they need, all the hosting credentials, everything, yet they decided to fuck with shit themselves and completely annihilate the server in the process (HOW?!), so not even the webserver works anymore.
I am fucking speechless, I made it so fucking easy to gather all info and files they need, all properly put into well named folders, along the documentation in an archive and they somehow managed to nuke the fucking server, while attempting to add ssh keys?!
If you don't know how to config a server, then don't fucking touch it and just use everything, that got served to you on a fucking silver platter.
---
I'll just instantly answer the most annoying comment, that somebody could come up with: "why didn't you do it yourself?"
Because in a perfect world, a fully managed team, can do much more than a single developer can, especially in the same timeframe and from what I heard of said client, atleast they did something in terms of developing the system. (which surprises me, considering it's the same people that nuked a server, while trying to add ssh keys)5 -
Taken partly from an article I just read.
Russels paradox is a problem discovered by Bertrand Russel in 1901 when studying set theory.
He describes a set that contains all sets which do not contain themselves. The set of all pornstars does not contain itself for example, so it can be include in Russel's set, as well as many others.
But what about Russel's set itself? It doesnt contain itself so shouldnt it be included as well? But that would mean it DOES include itself which means it DOESNT belong to the set. And it would keep switching like this, monotonically, forever. Hence the paradox.
If it is monotonic then where we begin in the sequence doesnt matter. So lets do away with that bugbear.
Now if russels set IS the set of all sets that dont contain themselves then we get a paradox.
However if russels set merely *has* as a single subset, all sets that dont contain themselves, then shouldnt russel's set with one level of indirection, contain itself?15 -
I’m slacking been so busy, forgot to post yet another book..
Soo here ya go..Engineering A Compiler.
For those who don’t like the Red Dragon compiler book for whatever reason, most don’t like it because they don’t believe the dragon book covers topics in a “Teachy way” and doesn’t explain certain things. As well as not cover one topic.
Then this may be the book for you. It’s significantly newer than the “Dragon book” and I believe it does do a better job laying out for “learning”.. I could see this book being used in universities.. I’m sure it is, but mine never had a compiler course so whatever. Good book
Fun fact.. it references the dragon book, as well as the other books the dragon book authors wrote as well as articles in the ACM..AND! It also references Knuths art of computer programming and other books of knuth AND references the Algorithms book. All books I have previously posted.
I have not read this book, only skimmed as I have recently received it this one. May do a follow up or even at it to the list to make a YouTube playlist going chapter by chapter thru the book.8 -
Fuck it..
What’s the point?
Why do we care about a point at all?
Why do we even try to make sense out of it?
I’m religious but if you think about believe long enough that’s a point to question as well.
I guess the 2nd lockdown is getting to me.
I’m extremely introverted but this I too isolated even for me.
In the the 1st lockdown I made it for 3 weeks, now I’m breaking after 1.5weeks....6 -
I’m fucking lost.
So, situation. I have a SQL table with about 3M rows (not a lot).
I have indexes. Indexes are used. BUT when I add where clause (On indexed column), it’s super slow. Around 10 seconds.
If I do select * (ALL 3M rows) and THEN I filter then on webserver side, it takes 0.5 seconds.
HOW my manual filtering is faster than DB filtering with indexes? I even tried bubble sort. Bubble sort is faster than SQL ‘where’. HOW ?!
I do not understand….
And if I add group by….. WELL, 25 seconds SQL time. 2 Seconds if I do select all and group by in code manually.
Does not make ANY sense to me.
What am I missing ?23 -
I believe Common Lisp people are up to something:
http://lisp-lang.org
and
https://www.quicklisp.org/beta/
......I ak fucking stocked at this way of coding making a comeback. I wonder if It has anything to do with M.L being all the rage now a days.
Oh well....M x slime3 -
Mgr: composer require. That's all you're allowed to do. I want you to manually go through our word press site, check which ones need an update. And do a composer require in the command line for each to update them.
Me: wouldn't it make more sense to just increment the version in the composer.json and then run update?
Mgr: no, you don't understand how composer works, it's very complicated. Just do require. Don't ever do update.
Me: *does it anyway (reverting later of course) and compares update vs require and their differences in the lock file*
I mean it looks like 'update' is updating important dependencies for each of the packages as well as the package itself... The 'require' just seems to download the package itself but no updates to dependencies for those packages.
But seriously is composer that complicated that I can't just do an 'update'?
I've been reading the composer documentation and it seems to be saying that update is the better way to go...
I'm doubting myself these days...12 -
!dev
Long time, no rant. Why is facial hair so difficult to control? How do people even grow beards without looking like hobos all the time? Do I have to make some sort of sacrifice to a dark and malevolent entity?
Believe me, it's so much easier to keep on top of shaving body hair than taming face fur. Especially because your facial hair is, you know, on your *face* which means it's very visible. You can't hide it if you mess up. Unless you decide that wearing a balaclava is a good idea when going outside, like when going grocery shopping. Generally that isn't received too well though.17 -
The week where you have so much to do on different projects, that even if you manage to work on all od them a bit it feels like nothing has been accomplished.
The point of being so tired that even the mildest sickness feels rediculously awful.
And it's friday. I manged to do some work for one of my bosses but the work I want to do didn't really get done and now I have two meetings in which I can say I started doing xyz but couldn't finish it due to bugs and exhaustion. And for the other project I wrote documentation.
Well.
T_T4 -
Fuck, fucking cock sucking stupid ass prick of a little black box, why, why the fuck do you not fucking boot any more, all you have to do is fucking boot but no, that's to much for you to fucking do!
Ah well, good thing it's only a Rpi!
It had a good life, now to wipe the card and start again! Irant no longer accepts keyboard input always on corrupt boot eject and reimage this old girl. rpi fuck it1 -
So I recently found out that just about every other company in this town pays their devs with equivalent experience at least 25% more than what my current employer does.
I requested a salary meeting and informed my boss that I'm way below the average for my position, he replied "Yeah, your salary has been below average for years now, yet you are my best employee in this area".
It hurts that he very well knew this fact and still decided not do to anything about it before I brought it up.
I told him that I don't feel rewarded for all my hard work and overtime, so I requested a 25% bump or I'm leaving in January.9 -
Fucking fuck fuck fuck outdated superiors that know jack shit about how software development works. Dnt even know about git, docker, cloud services. Everything is done on premise with network that is fucking crap and when an app is down "hey why is it down?" ask the fucking server and network admin how the fuck am i supossed to know? i have to create workaround codes when other devs just need to deploy their app and its fucking running as it should be. why the fuck do i need to spend my time debugging Ping timeouts? im a fucking dev. I have done designs, analyze requirements, build frontend, backend, optimize codes, paying attention to security and now i have to fix network problems as well? fuck off
Create Innovation my fucking arse. you just Keep saying that but then wondering "what is this new thing youre trying? its new and different why do that?" because you asked for innovation you fuck. If i copied some other concept its not innovation is it pricks.
Fuck them and all the brown nosers as well.1 -
I swear to god, if I read another medium post on how you managed to be focused and productive I will fucking... well... roll my eyes, make a facepalm and rant about it on devRant!
Who gives a shit if I'm unproductive and unfocused?!
Well, look at me now, I'm fucking productive while I write about you, you fucking peace off shit! And guess what? I'm not even using any of your 40 todo apps or time trackers. There is no pomodoro timer next to me or framed quotes from Steve Jobs hanging on the wall. Oh, I must be a fucking genius!
But what if YOU became unproductive?
What will happen when YOU start to procrastinate?
Do you really think the world would care?
Oh, but you are not really a writer are you? you're a developer building your app!?
Well fuck, I guess you're going to change the world than?
It's your big project. Your life's work, your legacy.
Let me remind you...
All apps will be abandoned!
All blog post will be forgotten!
Productive people will die!
Focused people will die!
Enthusiastic bloggers writing about productivity will die!
All CEOs and CTOs will die!
All developers will die!
Steve Jobs is dead!
In x years, you and I will also be dead!
Whatever you do, it's not really that important!
It's really not.
You're not going to change the world.
The world doesn't need another app.
The world doesn't need your advice on how to be productive.
You are not special.
Deal with it!8 -
Ok, so many people rant about windows update. It can fuck up things, starts unexpectedly (after 100 warnings and messages letting you choose when but ok) and it takes too long to update.
I use Windows daily so I update regularly and never takes more than 5 mins. 20 when its a major update twice a year. So let's talk about Linux.
Yesterday I wanted to try out .net core on Linux so I booted my antergos vm to do it. TLDR: Didn't do shut because, surprise, Linux updates.
So apparently I downloaded the wrong version of visual studio code. Uninstall and install the right one then. Nope, can't do that. Some dependency must be updated. That dependency is on the highest version on the AUR, I have to get a different one. Ok, no problem. But I can install the other because uninstalling the original breaks more dependencies. Well fuck then.
So I decided I'd do a full system update with pacman, shouldn't take long. 1.6gb worth of update. I have 200mb download so it should be fast right? Well, I had to wait a couple of hours.
So I couldn't do anything on my afternoon because of Linux updates. That's an original rant isn't it?
And before the comments get here, yeah I know it's arch, it's difficult and all that. This isn't about being hard to do. It's just annoying and making me lose time.3 -
WhaT DO you DO oUTsiDE oF wORK? tell ME SOmETHiNg INtereStInG, PreFerABLY noT RelaTED To yOUR joB Or iNdUStry.
You think I have "time" outside of work? I fucking huff copium like every other fucking wageslave, and we ain't fucking friends so I'm not going to divulge the exact types and flavors of choice for me to be judged.
I don't have the time, money or energy to fucking have some respectable instagrammable hobbies for your stupid like about wanting well rounded people.
We both know all you need from me is to not be an asshole.
At a certain point it feels like the industry is going to compete with girls for shit-testing people except we have whiteboarding leetcode as well.7 -
Well, I always say that if you going to make things a mess, do it a spectacular way. Today I kicked off a data import job that went bad, and in the process of canceling said job, I canceled myself, and the job went rogue, and became a zombie and ate ALL the system memory, bringing the server to a deathly crawl and throwing a dozen developers temporarily out of work for about an hour, before I was finally able to kill the zombie, and balance was restored to the Universe.
-
SINGLE
RESPONSIBILITY
FUNCTIONS
HOLY GARBAGE UNTESTABLE DIFFICULT TO DEBUG JFC SHIT.
FUNCTIONS DO ONE THING AND DO ONE THING WELL. LEARN IT, LIVE IT, LOVE IT, OR JUMP INTO A LAKE
that is all.5 -
Continue with my ALL-OUT year of JUST DO IT. Trying to see what happens when I go YOLO for a year.
It started well about 4 months ago, but I slowed down a bit. I just want to pick up the pace again and JUST DO EEET. See where it leads.
Been working on a lot of side projects. I want to finish a few. One is already pretty much finished.
Then, towards the end of the next year, I think I'll start looking for a dev job.2 -
I want you all to think back on how "transparent" and "helpful" everyone was to you when you were useful to the company.
And then as soon as you were gone, did they just complain and say something like "how could fullstackclown leave us??!?!?!"
I swear, the last call I was on, I literally heard the phrase "we are such a good team, we think up great MVP products and you guys execute so well"
Let me translate: "we are whimsical fucksticks and you are our slaves to implement it because we ourselves are too incompetent to do it"
Well no more.
Fucking tools, all of them, everyone just wants to use us to get ahead. No competence, no self-understanding, just encapsulate the "IT" or "tEcHiE" people to some department - doesn't even have to even be near us, they can be from any geographic location; they can just be replaced at a moment's notice!
Yeah, well fuck you, because we're growing in skill and understanding, and fighting against you.
Fucking 🤡🤡🤡🤡🤡🤡🤡🤡s
The unionized revolution of software developer is coming soon.3 -
"Do what you love and you'll never work a day in your life" is probably the truest statement, but there's a lot of people who get the definition muddled.
They think "Oh well that means there wont ever be hard days and there'll never be times where I'll struggle or get frustrated, and it means I'll go home at the end of the day feeling refreshed and ready to do it forever ad infinitum"
There absolutely will be days where you're fuckin done with semicolons or that you've had it with other devs, but the saying doesnt mean any of that. What it means is that while you may dislike the corporate environment or the fact that you dont really care for it after work hours, while you're doing your tasks in their purest form, you're not really feeling all too bad.
I know a lot of people have gripes with this statement. Pull your finger out of your ass and admit that either you don't love it anymore or that you didn't really understand exactly what it was you were loving all that much in the first place.2 -
As a .NET dev I get questioned about using VS Code in favor of full-blown VS. My arguments are that it is faster, lightweight and overall more user-friendly.
I use it exclusively, for all types of files and projects (JSON, SQL, Angular projects, .NET Core, ...)
Do you guys like using VS Code as well? What do you use it for?
Also, if you ever want to annoy a colleague, try associating all file extensions with Visual Studio and watch him go bonkers.7 -
Best way to avoid procrastination : We tend to avoid commitments or to do large tasks as even visualizing them seems tiring and the longer it takes, the vulnerable we are to distractions
So I use this simple trick
I break my task into numerous sub tasks. For example if I need to finish a feature before day end, I would first list down all the cases I can think of in order and write them down using actual pen and paper.
I then start implementing them step by step.
I mark them checked once done.
It gives me a sense of achievement as I see those checks besides the sub tasks and I can also take breaks between steps.
So all it takes is just first five minutes of planning.
I had to do the above procedure, for this post as well.
Hope it helps fellow developers
:) -
A post today made me think about this interview I had about a year ago... I shall tell you all about it.
Went to a hiring event for this company everyone was cool but this one guy (who would have been my boss) was a total arrogant, douchey, know it all.
So anyways cue interviewing with him a week later. He says if I give you task A, B, C and they need to be done by the end of the week in which order do you do them. (Note: he literally said abc not actual tasks)
Me: I don't really know how to answer that question without more information.
Him: Well I like to see how people answer it... So think about it for a second.
Me: Ok I guess if doing one task would help me do the next task faster I would do it in that order. Like I can use code or concepts from C to do B faster.
Him: What if A would take 2 days and B and C would take 1 day.
Me: I don't see how that would influence the order I do them in.
Him: Would you complete one task after another or switch between them or do see simultaneously.
Me: It would depend on my previous answer and what would be the fastest way to get them done but without more info I literally cannot give you an answer of like I would do B, C, A.
Him: Would you do the longest task first or the shorter tasks.
Me: I don't know I guess it depends on if it would help you or somebody else move forward with something if I got a particular task or the shorter tasks done first.
So cue more of this kind of back and forth about arbitrary details about undefined theoretical tasks for like 10 minutes.
Suffice is to say I didn't get the job and I'm glad.7 -
Well, I really have nothing to rant about these days 😅
What I do have is a request for feedback on a project’s video, m working on the project and will release it open source once it works decently well, and most of all, when the code doesn’t look so atrociously bad 😅😅
It is basically a C/C++ package and project manager.
It can create, build, and run projects which u make, and add library flags and include directories automatically if that library exists in its package list.
It also contains package (=library) manager which can, as of now, install, uninstall, and fetch info of any package should it exist in the package list.
I will be adding package upgrading in the future, although package list updates can be performed.
Also, right now it can only build binary projects. I’ll soon be working to enable creation of library ( static/dynamic ) projects as well.
Finally, it allows for building of packages using CMake or configure, but uses a custom format to build projects.
Here is a video of building a project and installing libcurl on system:
https://asciinema.org/a/155030
Thanks a lot ☺️😊1 -
I honestly don't understand people who genuinely believe formal schooling will cover all the basics they need to know to do a real-life job, and still get barely passing grades on all relevant subjects.
I genuinely don't understand people who copy GitHub projects to pass classes, and graduate from a university with goddamn StackOverflow instead of a brain.
Whom I understand even less are people who don't do anything major-related on their spare time.
I mean, change your fucking major, do what you actually like, do things that actually light your nuts with passion.
Please don't waste my time pretending you are in it not just because it's potentially well-paid and "cool".
Please don't waste my time being my coworker.
Yes, I'm looking at you, trendy wanker with a CS degree and no personal projects.
P.S. Junior here. Yes, I'm full of hatred for all the "real programmers" in the industry out there. I hoped for a better experience.
P.S.S. I mean absolutely no offense to people using either GitHub or StackOverflow outside of the aforementioned context.10 -
Not specifically a Dev job, but I did do a bit of development at this wifi startup. It was a wifi shop where we set up wifi for hotel clients all over the US. Anyways, they said I would make great money doing "on call" support, and me being an intern and naive I said absolutely I'd do it. Well 3 months later I was put on call essentially every day and one weekend I was with my mother and it was her birthday. At her party at this nice restaurant, with all of our close friends/family, I got a call. It took me 45 minutes to solve because of how idiotic the clients were, and after that I got 4 more calls equally as frustrating and long throughout that night. I asked for help from employees, the owner, ANYONE. Nobody helped. Needless to say I emailed the owner and said farewell that following Monday.
-
Translating win32 calls to whatever the hell there is in Unix and Unix-like OSes (well, most of them) in order to port a certain game net code library and dear god why did I volunteer myself for this task
At least pevents is there to help, but too bad cmake doesn’t want to compile it with the flag I need (“-DWFMO”) in order to make the “WaitForMultipleEvents” method to work at all. Instead no matter what options I give it on the command line or how I tell VS Code to do it, it seems to give me the finger to my fucking face.
Doing it for games on the cooler OSes... doing it for the community... come on...2 -
Why is school such a bullfuck, we've learned SQL basics and I've used SQL a little so I thought I won't have a problem. WELL FUCKING HELL WAS I WRONG. Joining 4 tables together with inner join WTF who the fuck uses that, why the fuck do I need to know this, WHY THE FUCK IN A TEST WHEN WE HAVEN'T LEARNED SUCH BULLSHIT. Well how about adding a foreign key to a table that doesnt need one. Well ok have fun with a key that does absolutely nothing and on top of all those convoluted tasks the texts are a mess, they give unnecessary information with grammar of a 9 year old and the pictures are not even readable. They are fucking hieroglyphs.
Fuck school.
Gonna do it by myself at the end anyway.
Fuck everything.15 -
**it's 17:47*"**
Dev: Hi manager I have those 13 tasks on me and I won't finish on time.
Manager: Well all those items needs to be finished on Time, how YOU are going to resolve it?
Dev:😵😵😭😤🥺
Manager: there is additional defect to check please take it on priority ,it a real easy one , I'll do it my self in 5 min but I'm too busy
Dev: ETA?
Manager : by the end of the day.
Dev: Well it's already end of the day.
Manager: Exactly, I knew I can count on you .
Dev:🥺🥺🧐
****Next day *****
Manager: Hey sorry to call you on your cell but I see there were no progress on yesterday issue.
Dev : Sorry Manager I'm sick.
Manager : O.K feel well (🤬)
Dev : thank you so much (😎fk you asshole😎)3 -
I once went to a client to get a brief for a website (the twat can't be bothered to write it, so he gets me to do it). I wrote all the details down and fired as many questions as I could. When I got back I wrote up the notes into a brief and sent it back to check before I costed it. He said it was spot on, so I sent an estimate. A few days later he must have shown it to another director, they both call me on speaker phone. Them: Will it do this, will it do that? Me: "It" doesn't exist, if you want to add some requirements then write or extend the brief and I will re-cost it.
They ignored that and rang a little later. Them: We have been discussing it, will it do .... and will it do.... Me: I repeated what I had said earlier, but my tone of voice had changed to reflect my annoyance. I never heard from these pathetic twats again. Moral: I always do background checks on a company, as well as accounts and financials check it's good to tap in to your network of colleagues, designers, freelancers. It can set the alarm bells going long before you commit any time. -
Does anyone else have that project that they work on in there spare time? Well mine was a Pokemon MMO because I'm not a games developer and found it a really nice challenge/break from normal work. It's almost ready to be played but it's sad that it'll never be released. I mean I could recreate all of the sprites and game mechanics but that wasn't what I originally set out to do.4
-
I only finished my CS degree last year but while I was a student and after I got my degree I went for a few interviews and none of the companies really asked me what degree I have or didn't ask at all, some just asked what I was studying. All of the companies asked what I can do and what my skills are. If I can do it, they were happy to hire me even if I didn't have a degree.
So to answer the question, a degree is not useful if you still don't know how to program (for example) or if you don't know your field well. If you are good at what you do, you will earn crazy money with or without a degree.
I know a few people that don't have a CS degree but their programming skills are crazy good...probably much better than a uni graduate with a CS degree.3 -
Combatting imposter syndrome is all about being more realistic with yourself imo.
Not in the way you might think. By realistic, I mean you NEED to regularly tell yourself that you are doing your best - especially in the work or areas that can promote insecurities of “not being good enough”. Acknowledge that you are only human, that all of us are different, that all of us make mistakes, and all of us have different interests in life. That, and practice gratitude for your situation. Your interests and decisions lead your different paths, so might as well embrace, enjoy, and love your uniqueness.
That being said, I also think it’s important to do difficult things. I think @wisecrack said it the best in that “real learning feels like falling”. Like the uncertainty of the abyss causes the most anxiety. Next time you feel like you don’t belong, recognize and separate that feeling and reframe it as a symptom to your own self improvement process. Take that risk and do things that are uncomfortable in the pursuit of personal success.8 -
Why!!!
Why must some devs make life complicated!!!!!!
So, here I am enjoying my day (well enjoying the meetings that are taking me away from working) when I get a bug report that script X isn't sending out emails anymore.
Ok that's weird, this as far as I know uses the same email class as every other email being sent out from this project, and they all work.
Let's go have a quick dig...
function sendEmail(){
/*do a bunch of stuff*/
}
Is being used, well that's odd, it should be $emailService->send()
But what ever, it's probably an old wrapper for legacy sake since this script was written years ago. But nope, I almost cried, it's a wrapper for mail() isolated into this script.
Like for fucks sake, why in the hell would this be used when there's an entire fucking class that's tried and tested and only looses 1 email every few months, coz shit happens.
Errrrr.... sometimes i really wonder why people can't just do what they need to do the first time round.rant i'm tired of fixing bullshit code emails why you no work php i don't get paid enough for this shit oh god that's why4 -
//rant
So i ordered myself a web server and am trying to get access to phpmyadmin.
I got generated username and password for the phpmyadmin login.
So i created mysql databases and database users, outside the interface, but that's fucking it, i need to create tables as well, can't do that without the interface, cuz NO ACCESS!
Fucking piece of shit service provider, they had one thing to do and they can't even fucking do it right. How dare they call themselves web hosts at all...
It's probably a badly configured config file but i can't access the file myself to start sorting this shit out, so i got to wait at least 12 hours till work hours to be able to contact with them and sort this shit out.1 -
My paper just got rejected. Again. The first time it was expected. But for this journal, it wasn't supposed to be. Some of the reviewers' comments are stupid. (for eg. I mention a no-loss algorithm fir a game which, so his/her comment is like what's no-loss? , like are you fucking kidding me, if you don't know that, then why are you a reviewer in the first place)
Anyway now I don't know what to do. I'm looking for more journals but all have so high impact factors and I'm not even sure confident to submit again. Had a good mind to mail the editor in chief but well, I don't think it'd help. What do you guys think?
In the middle of another project, another paper, online courses, now this. I'm just done. I didn't go home as well. It's around four o' clock in the morning here, so noone here is awake.
Can anyone hear me?5 -
So just opened Twitter at work to see Dark souls remastered is a thing... Instantly though "here we go, a $100 rerelease capped at 30FPS on console, oh well still getting it", went to EB games and read the description for the Xbox edition, running at 60FPS and for $60 AUD.... Dear all AAA developers...
THIS IS HOW YOU DO A REMASTER!!!!
Up the frame rate to 60 if previously capped at 30, upgrade textures and charge a reasonable amount for it!
Well done Bandai!3 -
Project requirements include a database. I don't have permissions to create a new database on the server, so I go to the person that spins up new servers and deals with group policy. They rustle some papers around, looking aggravated, throws up hands and says, "I guess I'm the DBA now..." Well, what the fuck am I supposed to do shithead? Ask the web team to do it? We don't have a DBA. My boss has been gone all week and, really, this isn't a hard task. You check a fucking box.
Whatever, I'll remember this when they need a favor from me.6 -
Some marketing people function on a whole 'nother level. They write internally in the same way they write to represent the company externally, using all the bullshit-laden buzzwords, using exclamation marks all over to convey fake enthusiasm. I wonder if they feel exhausted after doing this for a whole day. I know I would. But I suppose if it helps them perform better, well, let them do it, I guess.5
-
When scrum master/agile coach sais "I know, I used to be a developer myself." ....
Do they think it makes me trust them and drop my point?
Honestly all I think is "well, plenty of bad devs out there, and there's a reason you'r not doing it anymore"3 -
I like to code as a hobby as well as do it as a day job so it surprises me quite alot when people get all funny about me coding outside of work/uni. It's just funny because half of these brain dead students know nothing about anything other than what they're taught in education. Most students are so fucking stupid nowadays and they don't like to read or research or learn. But I'm the anomaly. Ok guys. Well done, go get pissed; it's the best you can do with your braindead selves.3
-
Fuck windows!
Now that I have your attention. My problem is with "IAR embedded workbench", not so much with windows but I'll get to that.
I've used that IDE for a few years.. 2 years ago. Since then I apparently forgot how to even create a project from scratch with adding all the necessary libraries and all that.
My initial deal with a client was to give them a solution using whatever tools I deem necessary. As I recently moved to linux and IAR is not available for that os.. and I also enjoyed working with CLion and PyCharm which Are available I decide to use CLion to write my C project.
A problem was that to compile code for microcontrollers I need tools unsupported by CLion.. oh well. I can do all the compilation and uploading of the code through terminal .. so I make a bash script that does it all. Super convenient. Development is going well and all.. until they ask me for the project.
I sent them the project so that they can see my progress. They can't do shit with what I gave them because they don't even have make on their machines let alone the compiler. All they have is IAR. But the guy that wants to see the code is not really a programmer.. he is a hardware specialist so I can't expect him to do anything more than use what he knows. He doesn't need or want to learn more right now.
So I go to windows and start porting my code to an IAR project and 2 days later I am still stuck with it. FUCK. Not only was the installation process horrible but the tools I wanted to install additionally did not work as promised either.
I know it took me about 2 days to setup all I needed on linux but I was enjoying it every step of the way. While this garbage is frustrating me so much. The fact that I used to do it before adds to the pain.
I am this close to telling them to just look at my code in notepad and I can setup a vm for them in which they can compile it if they really really need to.
If they just told me from the very start that they want me to work with IAR that would have been fine. I would have never seen the easier way and would have gladly figure it out then. Not now.1 -
Sometimes I do wonder why can’t I just be content at getting best I can get at what I’m already good at - and what brings in the €€€? Why do I go ”oooh look shiny intetesting language, let’s try do shit with it” or ”hey, let’s try this thing called kernel dev/pld/program verification which are all so far outside my core expertise they might as well be in a different universe!”
Dude I mean writing a kernel in V and doing proof oriented programming in F* are fun and all, but what good’s that gonna do me when I’m in all likelihood still maintaining legacy web apps in PHP ten to twenty years from now?
I guess what I’m trying to say is that I’m torn inside with my current workplace offering me everything I value and stuff that’s rare to find - but at the same time I’d love to be challenged more and don’t really have enough of those opportunities in my current environment. Or some shit like that.
Well fuck that, back to writing my own embedded DSL into F* in F#….1 -
So I kinda started a project just a week or two ago, essentially a CSV to spreadsheet converter that could also do formatting, so you wouldn't have to do all the formatting after you convert it to a spreadsheet. But now I just kinda think that it's not a very good idea and I'd just be wasting my time with it.
I was in the middle of looking through some of the source for LibreOffice to kinda understand how the files are converted and everything. But now I think I would be using my time better doing something else. Oh well.2 -
There's this weird situation where someone rants about their work situation and commenters dive in with suggestions and comments about what they should and shouldn't do without knowing all the details.
It really pisses me off not just when it happens to me, but I see other posters using devrant here as impromptu group therapy only to be bombarded with "do x or suggest to your boss...".
Now... I've been suggesting and asking the same thing to my boss for over a year, still no change. I'm demotivated because of the lack of progress, I can and do keep bringing it up with him. However having someone here (presumably well meaning) suggest basically the same thing doesn't help, it just reminds me of the frustrating situation.
When this place is supportive its great, when we're all second guessing each other it's frustrating.
Can we all be just a little more excellent to each other? I know I'll try to be. Instead of assuming someone hasn't done x or y, I'll try to be a little more supportive and assume that the most obvious things to try, has been tried.1 -
No matter the hard work you want to do, how much time you want and really spend to complete something, always a scumbag project manager will set the dates so that you won't make it in f*ing time!! Really now, it is frustrating!!
Well, I moved to a new company and all seems vanilla. But you know. Now I have this lesson to remind myself.4 -
When to log into an encrypted vm that I set up for finances, and realized I had forgotten my password, to decrypt it. Well after a few min I gave up and wrote a short program with all my sees, and rules for altering the seeds and combinations there of.
Got back a few thousand and plugged it into a macro script and went to do chores for my wife. Came back and was in.
To be honest I check on it somewhere in the middle and thought oh crap did I use my dogs name? I didn't but now I am switching to a password manager.2 -
Company sends email notifying us we'd need to register for two factor authentication because it would be mandatory for all access to email within a week. However, it had to get manager approval and had a side effect of giving us access to work from home (which my manager hates). So, we send the request to him, explain the situation, he denies it and says "that can't be right! Let's do this: if you do in fact lose access to email, then I'll approve it". Well, we did lose it, and just spent two days without any access to email and it was a huge pain to get the registration process done because one of its steps involved getting a validation code from the email.1
-
!rant
Guys, Im curious, what you would say about situation if you are in need of some quite simple tool and you write it but becouse you need it today, not tommorow, you just dont give a heck about all the fancy stuff and (lets say for php) you start to write all in 2-3 files like you was back beginner?
Or you just nope out of situation?
Do you refactor that when you bored just becouse this cant be on my disk, noone can see this abomination?
Or you delete after usage (only to relaize 5 minutes latter you need it back :P )
Im curious your opinion.
PS.
nope, if you came to bitch about any of opinions even opinion "well, i wouldnt give a fuck and just not do it", go away and get lost.
E: typo12 -
Well payed co-worker is always crying about others salary being more than his...Fucking hate that guy. Remember he is just a fresher and is being paid way more than he fucking deserves. Today he exploited someone to gain access of other co-worker's pay scale information and kept obsessing over it all day long...!
Fucking prick is going to get away with it...And I can't do anything about it...!!!4 -
All these companies not going the full 100% remote and requiring one day in the office, would it kill them to do 100% remote? My current role is fully remote and were spread through many timezones and still manage to work well, why don't companies see this and give an option atleast to be fully remote for developers?12
-
I hate extremist to the point where I became an extremist of hating the extremist.
If life is as simple as 1 and 0, we won't even be fucking evolved and alive till this far.
Every story has different perspectives. Different motives. Is it Kingslayer the one to blame? Is it the Queen's fault? Or was it Little Finger?
We look at one piece of the puzzle and we talk and talk and talk. Well not only do we like to talk our own thoughts out loud, we like to persuade others to join our thoughts. Just like what I'm doing now.
Does this all sound simple as 1 and 0?5 -
Any other IT company is like:
* Task -> Designer -> Markup coder -> Backend -> Finish
Our IT company:
Act I: "Art of setting up contact with idiots".
------
Items:
*Cave scripts (aka "typical task")
Designer: -- "DAFUQ?"
Customer: *gives another interpretation*
Designer: -- "Erm... really? White text on white background?"
Customer: -- "Make a decision by yourself. I was expecting much more independence from you. You are an expert after all."
Designer: -- "Well. I'm making decision by myself. The text will be placed *here* and will be gray-colored, because *bla-bla-bla*"
Customer: -- "I disagree."
Designer: *1 hour of silence later* -- "Well...k."
Act II: "Design meets ar(u)tist"
----
Items:
*Something, that was drawn by dumb kid while smashing his own head against desk. (PSD layout)
* Salt (to pour it on open wounds)
Designer: -- "I'm seeing this task *this way*"
Markup: -- "And how do u think i should get this done? Have you even seen what you made?? This is bullshit!"
Designer: -- "It's not bullshit! It's a sci-fi themed layout!"
Markup: -- "With gameplay elements and graphics from Alien Shooter??"
Designer: -- "Well, I don't care." *brings new edits and changes*
Markup: -- "????"
Designer: *smug face* -- "!!!"
Act III (7 days later, 9 hours till deadline): "Short story about boy, who was trying to hang himself, but instead fell out from window."
----
Items:
*Markup, smelling like it went through hell and back (x1)
* Markup coder with fried butt (x1)
Backend: -- "What. Is. THAT?"
Markup: -- "It's a work we should complete in 9 hours."
Backend: -- "WE?? I know u mean me, but that's a nightmare. What the f*ck were you doing all this time?"
Markup: -- "Well..." *finds out that he was only watching films and sleeping* "I was making this thing up..."
Backend: -- "You mean "f*cking" *this* thing "up"?"
Markup: -- "Not without it"
(*3 hours of edits and changes of color from white to white later*)
Backend: -- "Well, let's do this."
*Picks PHP and tries to bundle it up with MongoDB. After some time tries to rewrite everything to JS and starts shouting something like "F***CK" and looking for window to walk through. Figures out that he is on first floor. And that he is too lazy to go upstairs*
Act IV (3 days after deadline): "Pain and misery":
-----
Items:
*Something covered with insul(t)ating tape. (Final product)
Customer: -- "Really?"
Team: -- "Kinda."
Customer: -- "Well, thanks for your work anyway. It feels like it's going to disassemble right in my hands but it just works. Oh, also, you didnt made this in time, so your payment will be over9000 times lower. That's all"
Backend, on fluids: -- "Well...yeah..."
Markup: -- "Don't look at me like that. I really was doing my job."
Designer, with twitching eye: -- "Huh, I see. You worked so hard that we have nothing to eat now. Thanks for that."
Backend: ...1 -
I really resent people who reduce the occupation to tickets. Our world is just tickets, tickets all the way down.
"well the ticket just says this, but that's vague, so what should I do?"
You either ask for clarification, or you get creative with the blank canvas you were handed.
"well that edge case wasn't called out in the ticket's specs"
this is _why_ we do TDD - to design our code to be able to function as expected for ALL cases
"is there a ticket to refactor that?"
what?! no, it's your job to always leave code better than when you found it (within scope/reason of course)
FFS we are not hired to be code monkeys or glorified typists. There should be joy that comes from getting to be more clever than the average bear and to solve problems and improve things with your code and logic.
shit bums me out.7 -
Ok, so I have been lurking around here for a while now. Not at all knowing what to rant about. I like my work, I don't have to deal too much with annoying (or almost any at all) customers and all in all I feel fine.
However, I feel like I want to, in some way step into this awesome community in other ways than just comments and ++.
So this post will be about a book. It's almost our Bible. Well it's probably the closest thing to a proper part of the trilogy we will get.
And for not being written by Douglas Adams (the almighty) himself; this book is surprisingly good! If you haven't, and get your hands on it, do read it!3 -
Remember how I gushed about one note?
Well I purchased a new laptop today.
Load it up, log in to fucking windows 10.
What do I find in one note?
All my notes from my previous PC.
What did I explicitly fucking disable on my other PC?
Sharing and syncing.
What has obviously been shared and synced anyway, completely ignoring my settings?
My fucking notes in onenote, including some very personal notes on my health and life.
Can anyone else confirm they had the same problem?
I'm interested in pursuing legal action for this bullshit.11 -
Well, I am not sure whether this is supposed to be about worst experience as a reviewER or a reviewEE so I'ma do both. First as a reviewer.
So, on my first project in this company, I introduced automated build scripting (read: suggested, was "volunteered" to do it, then had to bust my ads to get it done). Prior to this, our process was run the thing in Visual Studio a bunch of times (don't ask) and package the resulting files. Well, new requirements made this not sustainable.
So after many many meetings in which I assured my co-workers that the script wouldn't cock up and go sideways and format our server (HOW???) and showed them how to work it AND added all the features they requested. I finally send the script out for code review. Oh the joy. Questions like: "why did you implement this?" Came from the guy who told me to implement it. "Can you change the formatting?" I checked and no. "Why isn't this to the code standard?" Because the code standard doesn't include scripting languages.
And here is the piece that takes the whole piss soaked shitsicle pie "I don't understand why we're doing this in the first place. We have a build process already, why do we need a new one?" FUCKING REALLY?!?!? YOU WERE IN THE GODS DAMNED MEETING WHERE WE DECIDED TO DO THIS!!! SET OUT THE REQUIREMENTS!!! LITERALLY EVERYTHING TO DO WITH THIS SCRIPT YOU WERE THERE AND YOU'RE ASKING WHY WE'RE DOING IT NOW!?!?! Fucking hell. I forced it through anyway because I had the higher ups all signed off on it, but seriously. Just because we're doing something new that slightly inconveniences you, doesn't mean it doesn't need to be done. Stop being afraid of change.
Side note: these people actually would regularly hold up process and product improvement because change is scary.2 -
For the past 5+ years all I’ve heard from DevA and DevB is what a mess our source control is, we should be using our own custom nuget feeds,..Monday morning quarterback this…Monday morning quarterback that.
This year the department manager gave them the green light to start from scratch. Like ‘green field’ start from scratch. If I were involved, I would have been excited with such an opportunity.
For the past two hours all I’ve heard is ..
DevA: “What should we call this namespace?”
DevB: “I don’t know, I can’t make that decision.”
DevA: “Yea, that’s a business decision. Let’s call it Common for now.”
DevB: “Yea, it’s stupid, but we can change it later.”
DevA: “What about logging project?”
DevB: “Well, how about Core? Every project should have a Core.”
DevA:”Ha ha…like .Net Core. I like it.”
On and on…it’s all I can do from throwing my chair right now.1 -
This is not a happy rant...
Got a new well paying job. Moving up in life. But my wife is not in the same place... She had quite a few career struggles and just lost her current job... It wasn't even a job she went to school for, just whatever she could find...
Now she's getting quite depressed. Luckily she's not envious at me, but does keep saying how lucky she is to have me.
I really want to help her somehow, but this is really a thing I just don't know how... And it just looks like she's not handling it too well. Joking about suicide and crying about being useless... She also keeps saying that all she can do now is be a housewife. We did seek out help for her. But still... I really want to give her better support. I feel useless here.18 -
So I was messing around in unity, as you do. And I made an explosion mechanic platformer. The scripts were all working well. I saved it for the day.
The next day I booted unity and my scripts were gone, and the scene switcher won't work.
So I mean, partly my fault. Partly google drive's fault and partly unity's fault.6 -
Someone mentioned that client want to use wordpress instead of they current website because it is cheaper! Ok lets see how cheap it is.. each time wp release update after updating you need go through all website and check if nothing is broken.. plugins will need update as well because usually they run on specific wp version. Fixing theme and plugins requires dev time.. despite all those things.. have common sense. Maybe it is good for some type of business to host few pages without any business logic or use as blog without scare to loose everything and do not store users data.. someone mentioned that it is secure to run anything because updates are the best security to avoid security breaches. So why banks are not running on WP? Why health service is not using WP?
-
Client Agency: "Well why did it take you so long to style the clickdummy?"
Me: "well I did not anticipate that you had that set up by a student who does it know his css. I had to fix many usability problems first."
Client: "To me it looks just like before. What did you do exactly?"
Me: "Are you serious? That thing was not at all usable before."
Client: "The functions were all there in the first place!"
Me: "Yes, but I one does not know where to click, that is no use, is it?"
Client: "Ok then what ever...I somehow feel like like you have gotten less efficient these days. "
Me: -.-""""!!!!
Client: "so would you please include some effects and make it shiny? I just wanted you to make it shiny."
Me: -___- "ok then"
-----
Client: "Now it's awesome, thanks."2 -
Random opinion question:
I'm working on a thing where the user provides a big CSV and we process it and put it in the database, or update existing records.
This data impacts other things, but the data isn't front and center as a group of n the application for them to notice / see again (well they can query for it).
I'm thinking of taking the CSV and then presenting them with a table showing how we processed that data giving them a chance to review it before they commit it to the database...
I like this idea for two reasons:
1. If something goes sideways there's a chance someone will see it and I'm not sure I can do enough validation on a big ass CSV from god knows where to be sure we're going to process it right... (I'm going to do some validation but just can't cover it all)
2. It takes some of the mystery out of what happened / is happening for the user for.
Anyone try this in the past? Seems reasonable, but lots of things do before they go sideways.7 -
Mine actually don't know shit about what I do but they don't try to describe it either. One day I told my father that as a personal project I was making a little script to fetch song lyrics and assign them to the music files I have in my library. Well he was all surprised like "Wow, and you can do that sort of thing?". Well, yeah, what do you think I've been studying during all those years? 😁
-
For some reason I would find it quite nice if Brackets or some other good IDE had a mobile version.
Since I don't have a laptop at this time and I'm a teenager that is dead broke, I might as well be able to work on my projects on my phone and just upload them into my drive for later use.
Because trying to do my school projects is annoying when all of the computers/chromebooks don't have anything that I can use.
(And because they're district devices, you can't do much except for what they want you to)
So I end up having to either wait until my actual programming class (which is an hour long, and since we're sitting down at a computer it feels like 20 minutes) or I could wait until I get home and do it on my desktop PC.
So yeah, I think it'd be nice for a mobile Brackets (or other IDE, I just personally like Brackets)2 -
Co-worker: "You don't need to know the math! Stop going on about it."
Me: "I think you do for some things, my algebra is not good at all, I need to improve it a lot and I just think you should too."
Co-worker: "Oh stop it, If the code runs it's OK!"
Me: "Well yeah, the code runs but you're over-fitting like a mad man and have a P-value of a bejillion."
Co-worker: "What!?"
"data scientist" -
I'll probably start my startup in Italy next January.
It won't even be related to technology, but I hope it will do well.
It will be a second-job, so not much time, but I'm gonna push into it all I have to make it works as well as possible -
I lose all respect for people trying to schedule meetings with me when they write the time zone initialism incorrectly.
It is well into EDT. EST technically means you want to meet an hour earlier and that you live in a different time zone than everyone else on the east coast of the United States. But I'm just going to assume that you don't remember that really annoying daylight savings time shit we have to do twice a year and show up in EDT. -
Honestly I don’t remember any particular one cause every interview is such a traumatic experience.
People on interviews are almost all the same, they just try to prove their superiority over you and break you.
I totally understand why, it’s because they think they understand what IT is about and in fact they understand shit, that’s why also most of computer systems are shit, cause of shitty people doing it who don’t understand how computer work, they can just copy paste stuff and do beautiful talks about how cool they are and how awesome their company is.
At the end ( at the edge ) it doesn’t matter if you know tech stack or not, if you have gazillion years of experience or you just started. It only matters if you can solve problems and how good and fast you can do it.
But well do your reverse tree in 15 minutes. I’d rather be talking about philosophy during the interview. -
Had this client for which I did some work on agreement. The agreement was fairly well laid out and the work was well defined. We delivered on time and he was all good. Move forward a couple months and this guy comes back asking for changes, upon which I said we'd need a new agreement because the last one expired when the job ended, but he didn't want a new agreement and to not make a point of it we didn't. We made the changes and I invoiced him, as we do, and then he starts accusing me of trying to rip him off and calls me a child. Stopped working with him after that3
-
I've seen far worse people doing what I'm doing, applying terrible practices and still being valued af.
Even if I do smth wrong after doing all the research and alternatives' analysis I know I'll do a proper post-mortem RCA, document it and learn from it, as a result I'll make a better choice to fix the problem and I'll know better next time.
I think I'm alright compared to them. So I don't wory about being an impostor.
Learning by good examples is a good approach. Learning by bad ones might be even better. The "good ones" are yet to fail and be replaced by better (or worse) ones. The "bad ones" are already failing and you can learn WHY you should not be doing it like that and HOW should you do instead to solve the problem.
Learning from good examples only works well if you know the back-story, all the WHYs and HOWs. People usually don't :) -
Heck yeah,
So an old Ionic 3 project wont work on the newest CLI.
I check around for the error, update some dependencies, sure enough it starts working again, all is great or so I thought.
Later something weird starts happening, upon pushing a new view on the navCtrl, the navParams are null on the next view.
I later find out that navCtrl is becoming navParams just on the first bit of the view loading, so I do a dirty fix just to keep working on the functionality from my browser, I know very well this will cause problems later on, this is just so I can keep working on functionality.
I finish all of the functionality and I'm ready to compile for android, I run my script, the dirty fix comes to bite my butt now.
I remove the dirty fix hoping for it to work just well on the apk.
Now gradle doesn't find ddmlib.jar, some 15 minutes of troubleshooting do nothing.
Fuck it, I'll just create a new project from the CLI and drag all the code there so that navParams work as expected.
Sorry Ionic, but the world is not our oyster when subtle changes in dependencies produce such unexpected behaviour, with some fucking view parameters!.
I'm looking forward to get done with all the current projects to jump back to native.1 -
To all the masochists who spent hours debugging misspellings:
1. Learn your tools
2. Learn good practice
Every IDE should point out when you're not using a variable you've initiated or using an uninitiated variable as well as at least highlight, if not simply list, every occurrence of the variable under your cursor and let you find all references or even display the number of references next to a variable at all times, and finally, every IDE should autocomplete for you so when it doesn't you know you've messed up. Good IDE makes all the easy mistakes hard and all of the hard tasks easy. Including running tests. If you don't know how to configure your IDE to do all these things take time and learn it. If you still can't figure it out, replace your IDE maybe...?
Also use the debugger. Preferably one that nicely integrates with your IDE. If you don't, check point 1.
Also write tests and *run them*.
Also if your misspellings tend to consist of a missing `s` at the end of a plural noun just call it `entityCollection` instead of `entities`. And read up on more good programming practices and naming conventions.7 -
rant == false && help == true
I usually don't like posting non rant stuff here but I need help.
How do you usually design your service communication class?
I am working on a mobile app which contains talking to a REST service, I usually put all network calls in one class. Down side if it becomes a big class it becomes a pain to maintain. Any thoughts?
For a backend service I usually go with Repository design and it is working out well for me. But for mobile Apps I'd like to see if there is a better approach4 -
Yesterday, I was expecting my merge request to be closed.
I've done all the stuff my tech lead told me to do.
All tests passes, green light boyzzzzz.
Gitlab CI pipeline passes, greeeeeen light I said.
In Jenkins everything f*cked up...
Why ??
Well it was a conflict with 3 other MRs, missing rebase from other dudes.
And because they were remote working, got to clean up all this mess.
That's was a day off.
PS : well that's was not so off, I could fix a UB on a ternary and extend a test which was not covering some cases.
PS2 : learn git damn3 -
So, we're apparently going to build a sort of social media(with competitions) for our software engineering project. I thought of a productivity app that would follow the GTD methodology (with my own additions), but my team mates thought my idea wasn't big enough for a team of 10. One claimed that he would do it all by himself in a week/month(Don't know what he said). Oh, well. Anyways, I'm going to build that software as a side project with a friend or two. I hope that goes well..
PS. We need a team name. Any suggestions?
I thought of Team Sudo lol.. No one liked it..1 -
Just finished my first microservice project. I'm so happy that I was able to do that hardest thing I ever did. It's just a side project but I think it will do well on my cv as I will be finishing university next year.
Just wanted to share this with you guys as all the rants really helped me to calm down when I was wrecking my head over some weird bugs.4 -
How is there no open, accepted, widely used standard to store & tag things like old family photo albums, diaries, books, etc.? Surely I can't be the only one who wants to digitise all this stuff to preserve it many years from now in case the drunk Uncle pisses on it, or Grandma's dodgy electrics burn the house down and it's all lost permanently. Or perhaps I am; it does seem that most other people doing genealogy work have the technical competence of a lemon.
Like, I get it, there's *some* online solutions for this stuff (not many and they tend to cost a fortune), but if I want to store it locally or in a private git repo or whatever... well, no-one seems to do it. I want to be able to interlink individual photos with their contextual pages in albums, store metadata about them, store audio recordings of older relatives with transcripts linked, etc. - and it just doesn't seem to be a done thing.
Ah well. Perhaps I'll do it all anyway as some kind of side project, then all being well my great great grandchildren will be immensely thankful if family history stuff ever becomes popular again.18 -
Never ask a friend or a close acquaintance to do something like a design. It's really hard to tell your honest thoughts about how shit actually looks and you end up settling for a lower quality resource than you could have acquired. I now understand that keeping things strictly professional is vital for a business's well being. Especially if you are dealing with people under you. And now I understand how hard it is to keep up a business face. My heart goes to all the working class. 😂
-
We had a debugging competition in college!! I was all excited abt it.. but it was a facepalm situation when I realised that the code had syntactical as well as logical errors while the purpose of the code was not specified 😂😂😂...
I was like.. what am i supposed to do??? Replace the entire code with hello world?!?!😂 -
In times like these I really understand the purpose of devrant. I reached a point where I am so stressed out that it affects my phisical health. And man does it do well to have a place to leave out all the shouting and "FUCK" 's. Also, I hope this one guy dies in a car accident but I would feel sorry for the car.
-
Having developer skills comes sometimes in handy in certain situations.
In my case I visited a new website but first I had to choose their cookies.. but.. it was a list of about 150 radio buttons (150 advertisers), I shit you not.
And so I was like: "No, I refuse to click each one of them". I kept thinking.. hm.. how am I going to do a mass-toggle-off? And then it hit me: if the button "toggle all" toggles all buttons.. then that means if I invert the logic of the call, it means I will turn them all off! And it worked.. it was something like: "toggleAll(!-1)" and I did "toggleAll(0)".
That sure saved me some time! Oh yeah and there are of course other situations when you don't want to use a scraper for getting all the;. I don't know.. menu links out of a page. Console > import jQuery > select all elements with 'a' and text() on their DOM node! It can be done with native JavaScript as well document.getElementsById() but yeah, there are plenty of examples.
Hooray for being a developer!2 -
That is strange. I have become developer at 27. Well, I 've decided to become a developer, to be honest, started to learn C++. I have tried lot's of things before: sale things, play bass guitar, copyrighting, driving a bulldozer. All reactions towards my choises was negative, and descision to become developer, programmer was like: "ok, do it"4
-
The most work hours in a row n a non-dev job were 14 hours, but they were the hardest.
During University I worked in a warehouse once a week. It wasn't that bad and I could rest my brain for 8 hours. But around Christmas time they wanted me to do some extra work (as well as everybody else there). So I had to carry 20kg packages for 14 hours. Three days in a row from 7am to 9pm. I had two travel two hours to work and home again, so I had to get up around 4:30am and went to sleep at midnight. I'm so glad it was only a student job and I don't have to do this in my current job. And I feel sorry for all those warehouse workers, who had to do this regularly.1 -
My boss asked us all to do a 360 review of
Our colleagues. I HATE ratting on my colleagues, even though someone of them are rubbish programmers. He’s the boss, if he doesn’t know how to tell who the bad eggs are, why should I help? It’s not like it get paired for for helping him or get any shares if the company does well.
I won’t rat of my colleagues.1 -
Do you think a #MITBragDay would go down so well?
Don't get me wrong WIT is amazing and I am all for it. Gender isn't even a factor for me working in dev.
The thing I don't enjoy is being vilified for being a male in tech. I feel like I'm the bad guy.11 -
Turns out the reason the selection of RA cores on the PS3 sucks so much dick is that it has a half-complete OpenGL implementation.
Fuck it, we're doing it live. I've got CFW, i'll dynarec if I damn well please. If it won't compile i'll fucking make it compile, I don't give a fuck about "sanity restraints" and "needing OpenGL 2" and "LV1 required" I can fucking replace all of LV1 and LV2 if I fucking want FUCK YOU
The Cell processor is pretty beefy, I could prolly do it all-CPU if I wanted.8 -
Okay, so, my company does some stuff around blockchain. I had source for smart contract prepared before and it was on 'todo' queue. So, time for it, time to deploy on Kovan, time to test it on actual chain. Riiiight? Okay compiled no problem, deployed, no problem, i plug into several gui's ABI provided by compiler, and... Well..
I still do not understand why each and every gui prompted me to send view transactions (external view), instead of, well, eval them locally, i checked the ABI manually, it is correct, i stripped it down, it is correct, all up to spec.
I try older version of offline MEW, to have older web3.js with no success that thing works properly.
Every
Single
Web3.js based client
Behaved
Differently
And none behaved correctly.
I would, like, understand, if I didnt use official compiler, but official compiler should for F sakes be compatible with official client.
Today this stole 6 hours of my life, I didnt manage to solve it, and I am legitmitely pissed.
Im getting close to re-implement segment of web3JS to be able to do the tests I need to do.
Its not like I havent done it before.... -
So it finally sunk in that now is not the time to develop a commercial app. I never did it because reasons (too lazy to explain it all), but I always wanted to and this time I was determined to do it, but it dawned on me that now is not the time. Right now I have to do well in college and learn as much as I can.
Sadly that sweet sweet passive income will have to wait, but I'm kinda excited. I have basically freed myself from the feeling of guilt of making slow progress on my project. No more of that voice in the back of my head "but I should be developing the project, not this random thing". Now I'll basically just try my hand at a fuck ton of stuff, see what I like, maybe get an internship with a teacher of mine, who knows.2 -
This Monday the website I created for my school will go online at 10:45 and about 50 students will start accessing it all at the same time making 20/30 requests each in the timespan of a couple of minutes.
I am very much afraid that it'll go offline or break. And I put my name on it so hopefully everything goes well and Heroku doesn't suddenly decided to restart the server because there's too much traffic.
TBH, I've been a bit stupid, I could easily reduce the number of requests per user. Might do it before Monday.6 -
I really wish Emacs had better integration with Windows. Vim is a wonderful text editor, but it just doesn't do everything I used Emacs for. If it were my choice, I'd only use Linux for everything, but unfortunately I have to use other people's computers since my personal system's hard disk is borked, and it's really unfortunate how poorly it works even with Cygwin. Oh well, can't have it all I guess.2
-
Hey DevRant Fam ❤️ hope you are all doing very well!, for awhile now i have been focusing on c# and I certainly do enjoy it! Though since I’m still in uni.. we have only been building forms which as far as i am aware is not used anymore..
So my devRant fam, I’d love to be learning more of the modern things and also building more modern forms using c#, I’m very curious to hear what advice you have for me, I’m very much happy to learn anything & I’m open to all of your opinions!.
Again thank you for reading my lengthy rant, I appreciate it highly!
Hope you have an amazing day/night wherever you are!
Best
Milo ☺️❤️9 -
This is kind of a loaded question because it's so broad. So I'll just throw my thoughts down on the idea anyways.
Honestly with all the way that game dev has come it's so sad to see just the increase of people that are so ungrateful and dont appreciate what went into making it. Complaining about small not a big deal bugs that occur, blaming the devs for stuff that's completely not up to them but the "idea man", etc. Although good things are coming out of it. Like children wanting to get into it more which is awesome and indie developers basically holding up the industry while majority of the AAA companies get their shit together. So I see all of that increasing. Also I'm expecting to see the Rust language start to be used in AAA titles replacing C++
Web dev I believe will just get more JavaScript improvement with new libraries, frameworks. I really hope the companies that had PHP5 legacy code get back on their feet quickly. But I hope we can become more accepting of JavaScript doing more than just webdev like Electron, WebGL, etc. Because I think it's great that it can do all that stuff. Is there better options hell yeah but let's let people do crazy shit.
Software dev well I see python making a bigger uprising and I'm hoping people become more accepting of python as well.
These are all just random thoughts so please take that into consideration -
The eggs have to make a symmetrical pattern in the box otherwise something doesn't feel right.
They used to do boxes of 15, which worked perfectly. Now it's either 6 or 12, both of which potentially require you to adjust the number of eggs you eat to get a symmetrical pattern.
It is both necessary and sufficient that the number of holes in the egg box should be an odd number.
Nine and fifteen work really well. All the other odd numbers are either too big, or negative, or prime, which would be impractical.9 -
Well, the solution works on the co-workers machine. Checked out the same branch on mine and it doesn't work. Tried restarting the computer, and now the application doesn't start at all. On top of that hassle I have to deal with creating tickets for something that in the end took three minutes to fix, just to verify a change in our test environment. That email-communication took all week.
How do you guys keep your calm? Because I'm almost bursting from this, it's so frustrating.3 -
Not a rant
What do you all use for taking notes? Preferably something that handles code well and is cloud based (or can be dumped into it)6 -
How do you keep up with this? How to stay motivated?
Management is getting worse. All they want you to do is reduce customer issues, reduce P0 and P1. Numbers aren’t looking good.
But with that also do that GIGANTIC piece of shit epic we assigned you this quarter.
Don’t forget to help that DUMBASS contractor to do this task he was supposed to learn the last 10 times he did it. By help we handholding.
Also all the manager can really contribute is by saying reduce the numbers because that’s what his manager says.
Also why aren’t the code reviews done?
Also attend a 9AM sync up call as well as a 10PM sync up call in the same day.
Gaaaaaaahhhhhhh5 -
When you think you finally know a programming language really well but then you start a project and want to do it all on your own but you dont even know what to do... so basically I'm dependant on tutorials and Google.. until I am good enough to do it on my own..
-
So I had this conversation yesterday while fixing yet another Windows laptop for someone else.
Other Guy = OG
Me = Me (Duh)
OG: So what are your plans after your apprenticeship?
Me: Uh, I'll probably start somewhere that's e-commerce related, kinda like my current company but somewhere else.
OG: Uh have you thought about being your own boss?
Me: Well yeah, but I wouldn't know how to attract customers and shit
-- This is the moment shit gets real
OG: OH BTW I heard that Germany is lacking AI developers, you should do that! It earns you shitloads of cash!
Me: Uhm.. well, that might be true b-
OG: There's no but dude, it's free money, you're smart.. I mean you can fix any computer, right? AI will be just as easy
Me: It's not like-
OG: Duh, don't make yourself look so bad I know you can do it!
Me: B..But I'm not interested in it at all
*silence for 5 seconds*
OG: Well.. I guess you do you then
After that we continued to have random chit-chat about his job and experience (He's a mechanic)
God I hate when people throw buzzwords around and try to convince other people to do what *they* want.
No, I don't want to develop a structure of 1000 ifs/elses, I'd rather keep doing what I'm doing, thanks!6 -
Some time ago I shared a story about negotiating a raise. After that I talked with boss a bit longer and he gave me a new assignment which is not really dev-related. His logic was that I know Java so I should be able to do this since system I'm going to work with is written in Java. Yeah, right.
I have to configure document-flow system, eDok, for our client. I have absolutely no idea about all this document processing and such, but oh well. It's his money.
To do so, my boss bought an serwer with Ubuntu and our client has installed it. I finished a beta version of my last project and today had to start working on this eDok shit. I tried to log in, but nothing was working. From the logs it looks like HDD has failed.
Well, at least it has happened now and not after I've configured everything 😅 -
My bandwidth is ordinarily a few hundred kbps, but whenever I torrent it can reach up to 2 mbps, while all other traffic from me and my housemates is stuck in the single digit kbps range.
What does BitTorrent do so fucking well, and how can other protocols replicate this success? Would the total available bandwidth be different if every protocol did whatever enables BitTorrent to summon bandwidth from thin air?10 -
So started building a game engine in Vala using SDL2, I have never built anything from scratch and decided to do it with no tutorials and just looking at the documentation on valadoc... So of course all of the pages for SDL2 and it's sub components show up fucking blank... Well isn't this dandy .-.
-
Boss: How much longer do you think you need to finish feature X?
Me: At least 2 weeks.
...
Me the day after: Well, it seems that I didn't need so much time after all. ¯\_(ツ)_/¯ -
Control your searches like an ADULT damn it!!!
So we have records that can have any of a bazillion different reference numbers associated with them. No big deal. Everyone does right?
Our customer's love to run reports and so we have this one option for "just look at a hell of a lot of reference numbers". I call it the 'fuck all' search.
Really it is just there to find something that you don't know where a rando string or number might be in the record and just want to do a "fuck all" search across a number of likely fields to find it... and then presumably you'd be an adult and refine your search from there. LOL yeah right...
Customers get lazy and include that stupid option in their reports and we get a lot of.
Customer: "I always run this report (that includes the fuck all search) and now it isn't working. I want records that have ID 2222."
Me: "Yeah well that was only working because you were rando typing '2222' in like several fields and it would find those .... but now you quit doing that so it won't find them. If you want ID 2222, click the drop down and search by 'ID'. That will find it right away."
Customer: "But I want to just search by 'fuck all search' to find it..."
Me: "But then you get all these other records too right?"
Customer: "Yeah but I just delete them out of the spreadsheet ... "
Me: "Look watch this <screen share> there, look all records with an ID of 2222 and no more extra records you need to delete!!! How great is that?"
Customer: "But why do I have to do it this way now, I want to do it the old way..."
ಠ_ಠ
(granted I could add their ID to the fuck all search but we try to avoid adding too much because it gets out of hand / stops being useful the more fuck all it gets)3 -
Hello all (App devs) I have finalized all APIs and here is the postman collection for you. I have been working on the chat page so excuse me for my delay but I finished all the system all that is remaining is the chat. I will be working on it tonight.
Please let me know if there is anything wrong.
Dev 1: thank you will see then asap.
Dev 2: why do u want to make me lost we said u deliver the chat first and then we move forward with the app.
Me: well I had some difficulties with the chat so I finalized all else and u can fix those while I fix the chat
Dev 2: no this is not what we agreed on. This is propostrous. I will not do anything anymore. I need the chat to finale x y and z.
Me: dude the chat has nothing to do with x y and z u can finalize those and then fix the chat!
Dev 2: no I don't understand this is not right.
Me: dude I built the backend I know what u need for x y z. Anyway why all the blame and the destructive approach?
Dev 2 don't think we r kids we r not kids .. (bullshit talk)...
This is the scenario that happens Everytime a pussy of a Dev is late and is ignorant of their job and all about blame it on the weakest point.
Therefore guess what's drafted ?!
MY RESIGNATION PAPER!1 -
Ive had it with this job. It it right now the most unthankful job ive had.
There is no thank you, no good morning or evening. No hey how are ya?
All that matters is the 10 deadlines we NEED finished still in 2023. There is too much to do and no time or guidance.
How are we gonna fix this if i keep screwing up everything i touch. How can i do my work if NOTHING is ever good enough in the eyes of colleagues or clients. Im well on my way to burnout and/or depression.
Happy holidays y’all! -
TLDR: Being taken of my assigned dev tasks to do a basic word mail merge.
Why am I doing a word mail merge again?
Oh yeah because the business are that used to oh well if it's more than two clicks IT will do it. The only bit that would be considered hard (using that word loosely) is the address block.
No totally not mad that you had me write a mail merge for dip shits guide which isn't being used. No totally not pissed that you now want me to drop everything I'm doing for this basic task.
The fucks can't even pull the right data. Here's the data for the mail merge. Great your missing some key bits. The fucking addresses and names of the people.
I think what's pissing me off the most is I'm not being technically challenged at all and any chance I get to do something that would be is taken away to do something basic you learn in school. -
I don't program for days on end. It takes a few weeks and then I fell good about it again. Sometimes I wonder if I even like programming. I do well in college, but I've never had a job as a dev (aside from student "research" positions). I'm worried that I'll just burn out and get fired or quit and lose interest. Maybe I already have? Can't think of any side projects to develop either, they all seem out of reach. Still figuring out how to cope with it. The test grades don't do it for me anymore.1
-
The longer I go at this job, the more I feel unqualified to be doing it!
My boss is giving all these really fascinating ideas and things to get done... but he's not really describing it well on how to do it... just to do it. My creativity is being tested...2 -
OMG I hate html2pdf.
WHY ARE YOU PUTTING ENORMOUS SPACES EVERYWHERE ?! WOULD YOU LIKE THAT IF I STARTED TO PAINT IN WHITE ALL YOUR WORK ? WELL NO BECAUSE YOU DO IT ALL BY YOURSELF !9 -
Today I removed all the stickers I had on my laptop, and it looks pretty clean and better now.
I still remember the day when I would do anything to collect schwag and free stickers. In fact - I joined devRant just to get those free stickers XD.
but yesterday I had to do a presentation in my college and during the presentation, I realized how stupid it is to have a laptop filled with laptop stickers.
What I used to chase in the past, is what I am getting rid of in present. And it is true with many other things as well. We crave things and once we get them it hardly matters to us.
I sometimes wonder what life is really about, and is there anything that we can cherish forever and not take for granted?13 -
Exercise app got it all planned out in my head (well sort of). All day at work I'll be getting ideas on how id make it.
Day ends and I feel motivated to work on it all the way home. Get in make a cup of tea boot pc create a project do initial commit to git.
And nothing. Motivation dead ability to think gone. So I'll sit there sipping my tea trying to get motivated.
Eventually I'll close it down and get motivation to start it again at 4am which isn't an ideal time to start a project. -
Programming project in first year. Particle simulator in C. I decide to switch to another degree and drop out 2 month before exams. My friend's like "I have to study for exams, you have time to do it all now". I say okay and spend a whole week of my free time doing everything. Hand in project get a B-. A week before the exams the other fucktard drops out as well...5
-
My team decided to do a MOB programming in one of our tickets.
New joiner: Perfect we did a mob yesterday .
Me: Great, that's good. How did it go?
New joiner: Well, we work together in the gaming room next to each other and trying to solve the issue. I think it's very productive.
Me: Awesome! Let's do it again today... When we started the MOB, all of them are using their own laptop. And I was like.. so, this is how you did the MOB yesterday?
New guy: Yes.
Me: This is not a MOB programming... MOB programming uses only 1 screen, 1 driver and everyone work together, will tell the driver what to do, we need to exchange the driver every 10 to 15 minutes, everyone can be a driver. (devs, qa, ux, product) and do a retro after.
New guy: ah.. wow! Interesting.3 -
There are few layoffs in my company due to COVID-19 and so now there's 3 times more work then usual per employee and fucking senior manager keeps on threatening that if we don't meet the deadlines, they will get us fired as well!
Have to do overtime every fucking day, also even on weekends, my life has got all ruined and couldn't do anything about it as getting a new job in this time is going to be a pain in the ass as well!7 -
btw I made an instagram account dedicated for my tangram designs ( I do a new one each day for the gf to guess ( w/o the weekends 4 her ) and tought I might as well share them with the not so big world ).
Almost all of them are made by me ( I do copy some from the net if I got lazy or forget to make a new one ( I do them the previous day ) ) so hopefully some of them are not on the net already
If you are interested to check it out : your_daily_dose_of_tangram ( and yeah, I know... but we all do it to some extend either way ;) )1 -
Sometimes I ask myself how former IT people can become "Bosses"
Boss: We need to validate all links on our site
Me:Okay, let's vrab the response codes and some variations of under construction and we should be done.
Boss: No that only tests negatives, we need to test if the website content still matches.
Me: How?
Boss: Hmm... Just test if some keywords exist.
Me: So you want me to add a bunch of keywords for +-150 links? What about the maintenance?
Boss: Well, those sites basically never change.
Me: Then why do that?
Boss: Well, for when they change.
Now I can search through 150 mostly legal stuffy pages to find usefull keywords only to get a bunch of wrong negatives because the fucking semantics have changed...
+I have to type all that shit. Primarily, I have to type.3 -
It's strange... We had a proper issue related to web dev but no one asked me to take a look...
And well usually for issues no one can figure out, they usually come to me... But it seems feels like they're avoiding me.
¯\_(ツ)_/¯ maybe I'll just watch on the sidelines though the issue is if they ever do what up coming to me, the issue is then super urgent since they wasted all the time and users are now pissed as hell....1 -
Didn't know how difficult is to work with UDP protocol, doing local tests between two PCs in the same network it works well but, connecting to a public server over the internet has become a PITA, you have to do some shit like hole punching or UPnP(some routers but accoding to some users on the net is not reliable) or some others shit in order to connect it
And all that is because how NAT and UDP works, libs like libtorrent(C++) can connect using NAT-PMP, PCP and UPnP, but nothing in C# that can help with that, this is a game of pure guessing4 -
Curious, do the Recent and Top feeds show all posted rants, or is it different for each person as well?10
-
I had this amazing friend during my Bachelors and I think because of her I started to learn programming.
Long story short, IT(not just IT though) curriculum in India is shit. So you do not really get to learn during your college. It’s completely on you and how you self teach. This friend who I am talking about not just learnt all this and did research for herself, but she tried to teach and make others aware as well. She organised DjangoGirls workshop in our city where I participated. That’s when I really started learning stuff useful in real world. -
I have my IntelliJ builds set up to make either a pleasant ding or an unpleasant gong sound when my build succeeds or fails respectively (it's a multi-minute build, so it helps when I'm off doing other things while waiting on it). I think I'm going to spend all day tomorrow trying to get Nandor from "What We Do In The Shadows" saying something like "Hooray!" and "It is broken" for success and failure. I'll have to re-watch all the episodes so far, but I'll pay that price gladly. I feel like that would make my life immeasurably better and will be well worth my time to my company, right?1
-
Hey all. So I'm a bit of an aspiring developer/engineer. I am in highschool right now and am getting to the point where I should start looking at colleges. Ive wanted to do something computer related and for a while now ive had my heart set on some sort of security engineer/tech/researcher what have you. But it has been pointed out to me that computer sciences often require several high level math courses namely Calc. Problem being I'm pretty bad at Calc and haven't been able to do too well.
I'm not too sure what I should do. I'm struggling with my highschool calc classes and and fear that college level course will just go over my head. Ive never had issues with math before until I got to Calc. Ive got some of the basics of cryptography such as hashes and cryptographic alorithms but thats about it. Do computer science degrees really rely that heavily on Calc?7 -
It's important to have a little fun with what you do. You can work on and on like it's a chore and get along with it just fine, but right below the surface of the tools you use lies something truly interesting. Reading code, documentation, blog posts, what have you, all of it is just as helpful in learning as writing code.
And also, be kind. We all write crap code from time to time. As a beginner, I know I do. It's important to take it all as a learning experience.
Personal favourite quote that puts it very well: 'I guess you could call it a “ failure,” but I prefer the term “learning experience".' -
2 weeks ago I ask my coworker, who btw hates me and try to sabotage me every time he can, for a login for our brand new dev-system (webserver + dbserver).
I needed 8 days until he told me "no, work on the test envoiriment".
I escalated it to my boss, but he told me "no time, do as he says"...
Well okay.
So 3 days ago our bosses boss boss came to me and told us to do this very very important things - or we all will be in HUGE trouble and someone gets fired.
So I do it, I work as hard as I can, finished yesterday.
Today my coworker decides to play with the testsystem, because it is a testsystem, and boooom - accidentally kills a few databases and stuff for this very importent thing. Non recoverable.
And that is, guys, why you never work on testsystems.
He will get fired friday.
Karma5 -
Exams are done, i passed some subjects that made me almost drop out.
Felt good. Now if i manage to do well again in exams i may finish the uni on time.
And now here it comes. One of my professors saw that i was coding my self in contrast of the 90% of other students, and with 2 more guys from my year, suggested us to his friend that owns a company, so we could work there.
I went there, talked about the team and the product we have to do and it seems that for now the only developers are me and 1 more girl and 1 more guy, all new commers, not even juniors.
Shiet. The team told us not to be worried since they will be our instructors and help us out and if we need more help they will hire a senior dev.
Not sure how i should react to that.
I do that mostly for experience so i can leave the country when im done with uni to go to estonia holland or finland.
One more thing, we still don't know what languages we will use and even though i told them that im pretty good with python they seem not to consider it at all. I'm the only one of the juniors that has actually made projects and coded on his own, not with university projects.
Also so that all other employees use windows machines.
Sad.
Hope all that goes well.1 -
Question about managing git branches.
For releases, we branch develop (the main branch) into a release.version branch in which we bump the version and do any last minute bug fixes for issues found in testing.
After the release we need it back into the main branch as well as master.
But also we keep the branch as well in case we need it such as for a hotfix release.
Is keeping it right though?
General issue on my team I feel is nobody deletes their feature branches after they are done and merged into the main branch. I think there is a feature in most Repos where it can auto delete these branches when a PR is merged.
And well branches themselves (at least the HEAD) are sort of just bookmarks. All commits can be accessed by their hash and basically is a full snapshot of all the commits that upto that point that it was based off of?
So you could just tag the last commit in the release branch with release.version and delete the branch itself? And that I think is the correct, normal way?
Not sure how to explain this to my boss or team as they aren't big on technical details...9 -
I created a backend thing (mvc) yea all that stuff, Controllers, services, models, views and all that. No i turned out that i also need to do the frontend aswell. Last time i did that was >10 years ago, there was no jquery, angularJS and stuff...
Well ok ill give it a try with angularjs and Wow now i can again create models, Controllers, services, views. Wtf lol
Its like an inception, i wonder when there will be a framework for creating cooler views in angularJS -
I have a biorhythm thing. Every day at around 5pm I get so drowsy I fall asleep in my chair while working. If I happen to be driving at that time then my drowsiness becomes a potentially lethal condition.
It lasts for ~30minutes to an hour. Every day, no matter what. Coffee won't help at all - if anything, it makes it a lot worse.
It's been like that for well over 10 years. Anyone else has smth similar? How do you fight it? Powernaps help, but if I'm in a meeting I can't have them.12 -
Hi everyone well we quit gg scripting cause we figured out lua can be converted to cpp for memory searches! we all know lua and know how to convert it to cpp but for the gui
How do i learn java?8 -
So yeah, need money so I started looking for extra projects to develop and found a project to make "the new facebook" and it just kinda sucks.
I just got access to the whole codebase and it's done using angular, nodejs and typescript (which is cool to me), while the dude contacting me was telling me it was done in react (which is kinda a big no for me).
Well, anyway, I start by cloning the repo and the npm-i the whole thing, it's not even at 10% of the whole process and I already got like 50 deprecated packages over maybe a hundred needed (total of 2054 node modules installed).
Well I kinda don't even know where to start from this, all I know is that I'm gonna do it just for the money so I'll be a little underpaid (about 500$/month) while according to me the price should be about 1500$/month, but I can't do it full-time, so it kinda works out.4 -
"hey come try this good chat program called demonsaw"
5 days later:
developer: "i have no idea why it's so unstable for you only, at this point i'd suggest trying a different distro"
me: *tries a bunch of distros* "yeah all of them are just as fucked"
we went through "well is it DS' config? Is it your kernel? systemd? debian misconfig? libs? hardware? network? other shit running? ulimit settings? does Windows do this too? How about OSX?"
i feel so bad but we have no idea what is happening6 -
Continuing to talk about my previous post:
https://devrant.io/rants/814261/ -> link to the posting.
This weekend I've been sending some resumes to see if I can get a good spot, I still keep looking for a good remote spot, because here companies are not accustomed to paying well and not to pay their passage to the workplace (but they require you to go there to do Something you can do from your home, much less your feeding cost.
In this previous post some colleagues of profession gave me tips for I got good remote jobs being from my country, I hope it all works out. -
How do I know I’m not developing fast enough?
I compared to a lot of students at my university, I find myself working the opposite - documenting and planning first, then coding.
Everyone at my school seems to be hitting the keyboard and just hanging out solutions in a day for our labs.
Even at my internship, I sometimes found myself staring at existing code bases for a week before I could even do anything.
Is this normal? It’s so hard to know how well I am doing when it feels so hard to measure...I mean, even with all the tools of git etc, should I even be measuring?13 -
A medical equipment that you can attach to employees and excruciatingly kill them as soon as they say things like (please note that the list is not limited and we should use a speech to text API to provide NLP states for the meaning - I want to catch all false negatives!! Kill them all!!!!):
- It works on my machine
- I tested it before!
- Haskell is a terrible language
- Big data and actionable insights
- why do you need unit tests here?
- I am a recruiter
- Anything that comes with the following construction as well: "I don't have anything against X, but..."
Any other suggestions of phrases?2 -
I've adopted this per task desktop management think. Anyone else do this?
I make a new desktop, for a given task, support ticket, or whatever. And when I'm 'done'. I keep everything (ticket, whatever I was working on in vs code, related emails) open but minimize it all except the pull request waiting to happen.
If I get some feedback on the PR / changes I just fly through my virtual desktops and there it is and I'm ready to work.
Then after the PR goes through ... I keep it open for a bit anyway to be sure nothing bad happens.
Then after a while I shut it all down assuming that it is working well.
All this so I don't have to fire everything up again for a rando request or dork up or whatever.2 -
I have been having one of those days, well weeks where new concepts that would have otherwise taken a few hours, to learn and implement are taking days !! I don't know how y'all consistently learn new things and implement them, while still meeting deadlines.
My team usually holds weekly progress meetings where we discuss completed tasks and the following week's tasks. During the last meeting, I hadn't completed anything worth noting and I had no major reason other than, not having fully understood the concept.
Which is embarrassing because everyone else had done something.
I know, I know, I shouldn't compare myself to others but we all know my boss does. I don't blame him though, I mean I always pick the cake with more icing, and that's just food!
I don't even know what to do about it anymore!!! Is this a phase? Is it normal? What do people do about it? wait it out?3 -
Hey DevRant Fam <3
Hope everyone is doing very well as always!, i want to say sorry for my recent lack of activity in our community, i absolutely do miss communicating with everyone here as always dearly! there has just been too much going on within my life recently and i personally just needed a good break from everything , though to be honest more work was done than what i call my 'break', but guys not too much to say, about a week ago i turned 23 and things are finally starting to get a little better for me :-).
i'm also nearing the end of my degree in IT which this sem I've actually been working on a project for my first ever client with two other team mates, though i honestly feel that two of us are mainly carrying the team and the workload of course, but even so i must say i love learning all the time and its a real honor to do something i love and of course do with all of my heart :D.
as always everyone once again from the bottom of my heart i hope everyone is doing very well, and wish the best for you guys !
Milo <3 :D3 -
Hey everyone! I hope all is going well today & of course happy Friday,
I've had a thought in mind not too long ago and would like to talk about it to get it off my chest, very recently I was talking to someone about programming and how I enjoy playing around with the back-end side of things & playing about with output and data.
Yesterday I found myself trying to create a GUI application and found it quite difficult as I do not really enjoy the aspect of trying to figure out how I want it to look - It honestly felt as if i'd prefer printing things out to the command line and seeing if the output is correct etc... Not sure if that's weird or not? what do you guys think? have you ever been in such a situation or thought? :-)
I'm sorry if my question is a little all over the place.
cheers2 -
This may get me some hate from y'all but let me make a confession here.
I have taken away clients from my previous bosses when they made the mistake of giving the client direct access to me outside the company.
It happened in 2019, my manager gave the client my phone number so they could directly call me and assign me tasks. Well, I left that company and took the client away with me. Heck, I even made more money for the next 4 months from the client than the company was paying me.
Again in 2023 when I left my job, I sent out LinkedIn requests to all members of the client's org, hoping that they'd remember me and reach out for projects. Well, 2 months into leaving the company, they did reach out and now I'm making 3X what I was making before.
I'd do it again in the future again and again. If YOU and I partner up to work for a client, I will make sure that you are out of the equation ASAP.
There, I said it. I've done it twice and I'll do it again in the future.4 -
This week we started trying to do agile the right way.... And well so far for Sprint planning had 6 meetings over the last 2 days.... For work that I have little involvement in and well if they'd just let me do and demo it... Would've taken me a day...
And now I'm behind me on all the other projects I was working on.... That I could've worked on during those meetings where I basically just sat like: I need all to get u guys too ur shit done first, so I can start my part."
I'm the api guy, they're loading/creating the tables the api needs to use.5 -
https://github.com/netlify/...
This repository has been archived by the owner on Oct 10, 2022. It is now read-only.
Well fuck, whats the alternative? Absolutely NOTHING in the README that points to any new tool or documentation.
I swear to fucking god I write better documentation for MY FUCKING HOBBY PROJECTS THAN YOU BILLION DOLLAR VALUATION FUCKING DUMB FUCK STUPID FUCK COMPANIES THAT WASTE MY FUCKING TIME EVERY DAY AND HOUR AND MINUTE AND SECOND I HATE YOU I HATE YOU I HATE YOU I HATE YOU
I swear I HATE all CA software employees, all that they stand for, and all that they do (apparently not much)
How the fuck can I list out all my users? Just fucking clowns.
God I'm fucking fuming. How irresponsible is it to archive a repository (thereby blocking new issues) and then NOT linking to any new tool or documentation!?!?!?!
I MEAN HELLLOOOOOOO AM I SPEAKING A DIFFERENT LANGUAGE HERE
just leave me to die5 -
Ohh... really....
So I bricked my phone last week and had to factory restore to get it working so lost all my apps and data...
There were a few I created for myself and use but I don't do Android dev anymore (and Google decided to remove all my apps from the appstore but then again I don't care, no one uses them)
Anyway I couldn't find a good replacement on the app store.... so i pulled up the source code from my back up drive... and luckily found the compiled APKs too :)
But thought well heck might as well just publish the code but apparently... it was already published...2 -
Nextjs
I just realized
unit tests and integration tests dont exist in nextjs
So now i wondered
What about integrating AWS cloud functions with nextjs?
What about docker with nextjs?
Kubernetes with nextjs??
How TF do u implement a CI/CD pipeline with nextjs if there is nothing to test?!?!??
Nextjs seems like itself is self sufficient. WTF? Everything has been packed and cluttered into 1 giant pile of horsedump and called Nextjs Framework where you dont need k8s to run it or anything. Might as well then rename this fucking "framework" to GOD of all frameworks since it appears it can fucking do anything and everything without requiring HEAVY DevOps bullshit.
ALL of it can be cluttered in 1 nextjs project and you have a fully functional production working website that can basically do ANYTHING and EVERYTHING.
How???
Am i fucking going insane? Am i missing something here??19 -
Compare and harmonize the web configs
Oh no someone set execution timeouts to 14 days
Fuck fuck fuckity duck
Hey compare all the web configs of all environments and harmonize them all wtf cmon bruh do your job as a developer
Take them and back them up into svn. What do you mean svn isn't a back up system of course it is well its the only thing we have fuck
What do you mean we have shit logging where people will catch an exception and only print the word exception in the log you can figure it out can't you we have live produxtion issues that hace to be solved now what the fuck
How dare you make a. Mistake copying our shitload of a bloated codebase and configuring our 100s of different options all by fukcing hand what the fuck dude do yoh write anyrhing down?
Please catalogue all the exception mails we are getting but we have no db or error reporting system so they all just plop into tue inbox and thats all ypur fuckjng data figure it out kid
This is a rewarding, fulfilling job whwrw you can be both dev ops and a developer and manage all of our fucking environments of which there are about 15 of all your own with no sort of tool or software to aid you because haha what the fuck we wouldn't make your life easy
Whata that you want to spend time to write stuff or change stuff that will nake it easier fot you fuxk that bruh get back to your biklable tasks like holy shit you thjnk this is a charity ofr aomw shit
Live production issues
Live production issues
Produxtion issues. A ghost in the machine. Find it fix if find it fix it find it fix it cmon why can't you fix it I expect you to spend your day hopelessly pretending to try to solve something you fucker
One of the only peopel able to help you sometimes though hes a bit of an old laxky, yeah hea fucking leaving see ya seeya kid and now we're not hirinf anyone to fuckjng help you no no no managing and monitoring the environments its your jov alll fof them every sngle on do you knkw all the xonfiguraiton values for them yet??
Instead we are hiring a new sales person to fucking make us some more money and we don't need naother seceloper to help you infqct lets have you use this mid end retail computer from 2014 to develop on yeah yeah oh but all our shitty code and visual studip will destry your memory but too bad!! Hahahahahdhsj
Go lice is all you, why sare you so slow
How long will it take
How long will it take
How long will it take
How long witll it tqk2
How long will it take holy shit
Give time estimate for sonethign that I don't fucking know how about it will tqke till fuxk you oxloxk4 -
Think of an awesome sounding AI project while not knowing a thing about AI.
Tell the guy you will be working with that you will manage to keep the learning pace up (he doesn't know AI as well, woah!)
Fast forward 2 weeks - completely forget about how I wanted to do anything with AI.
Fast forward 1 week - that guy messages me that we ought to do a meeting to check how much each of us have learned and to decide on how we will tackle the project.
Somehow managed to get the deadline to be day after tomorrow.
'I am screwed...' is what I think when I skim through pages of 'Artificial Intelligence a Modern Approach'. So, I put down the book and try to find something easy to understand on youtube. I find a hyperactive looking guy that under a video titled along the lines of '5mins and you are linear gradient pro'. Not suscipious at all.
Watched video twice, managed to understand that I need calculus for this shit. Oh well.
AI seems so much fun until you understand that it requires a fuckload of knowledge to do anything at all! :'(
Going to try to analyse linear gradient until tomorrow and hope that it will be sufficient for our project.
Lol. Who am I kidding? -
iOS/native app devs!
How usual it is for your apps to differ from iOS UI guidelines? Our lead dev always throws a fit when he has to implement custom stuff, but I see popular games “shit all over” these guidelines all the time and do very well in popularity.
As I’m no expert, please tell me if it is generally accepted to not follow these iOS rules / use premade controls 100% of the time, so I know what’s up. Thank you.2 -
So, next monday I will be starting a new project in my company, the very first I have to manage as a sort of project owner in addition to my usual develer rolem. I will be asked to manage the relationship with the customer and all' the details, issues et cetera. Well, I dont know if I am ready and I tought to ask here some advices. So, what do you experienced developers suggest to a fresh meat? (2 years experience pro it world)
-
Spent like all week working on a feature set in a web app, finally got to a point where i thought it was functioning well, ran tests, tests passed.
I was exhausted but happy. All along i have been pushing to my GitLab server. I save my commits and even though exhausted, i am happy as i go to bed.
I wake up, run some errands and my business partner says, eh! Can i come see that new feature set you built, sure, i will be home soon.
I was at the barbershop, trying to look like a human being again. I get home boot my computer and i scream.....
Arrrrrrrrrrrrrrgh
I check GitLab, i check my Git Log and i start to sweat, i was in the air conditioner but it felt like someone turned the heat up.
Git log shows my last commit was 2 days ago, my app is at the state it was 2 days ago and i can't frigging find all i have built.
I need to show this to the client, have no idea what to do now, so stressful. My partner say, you know what, just watch a movie. You built it before, you will do it again.
This happened to him a while ago and i gave him similar advice, it felt wicked hearing it now.
Anyways, i have to build that ish all over again, i do know i wasn't dreaming about having built it. I asked my wife and she said, i did, i was always working. So confusing.
Anyone experienced this before, i have no idea how to find my code.
Help Meeeeeeeeeeeeeeeeeeeee4 -
I just bought a Pixel 2 so I can have live captions...
Apparently it has Android 10 support as well...
Why didn't I think of this earlier.... Though apparently support was only added in December. But just $100... And well I had a 60$ gift card balance left so that can't out to $40. (And it's only a 3yr old phone... Amazing how fast prices drop)
Actually I ordered a 3a first but then found out pixel 2 can do it as well... but now I'll have 3 phones...
OP1 (sitting in drawer unused for a few years), OP6, Pixel 2.
Guess I'll finally have an unrooted phone though I can use for all those apps I can't hide root from...1 -
I had to write a js bpmn flow designer for a huge bpmn app on request and my crazy brain said fuck it I can do it in 2 months, let's just say I made my deadline with school and all. And it actually worked very well it needed only a bit of bugfixing when it hit QA.
-
Swear some people just want you to do their fucking job as well, why the fuck would the connection strings need to change if the code doesn’t even reach that line maybe try looking again right at the top where it prints a message saying what arguments are required and try using them. Come on if your that stuck step through the lines 1 at a time from the start and it will all become blatantly fucking obvious
-
Hey Everyone, first of all I’d like to start with my usual, hope all is well today as always! Today I’d like to post my first official rant.... so anyone that knows me in person or in general knows me as a good helpful young man, right now Milo is happy but has the urge to rant..
So... not naming anyone specifically from uni... one person specifically always on Facebook messaging me for my assessments, now me being me i try to say No, but the issue is i want people to do well, i put my heart into my work and people just want assignments handed to them on a gold platter, it takes me a lot longer to try and get concepts around my head , I usually always stay up late nights to get a better understanding of things. As you may see my work means a lot to me.
I always mention to my friends if they wish to do well, they must sacrifice going out clubbing or other social things for a later time. I spend my majority of the week learning new things related to programming Monday - Saturday, and on Sunday i have my free time , with the usual work out session thrown inbetween :-).
So anyways, thats it for my rant, I’d love to know if anyone has been through a similar instance? If so would love to hear about it!.
Thank you for taking the time to read my long rant once again :-)
Milo 🥂☺️5 -
Hey everyone - Hope all is well :-), just curious I've been using Ubuntu 18.04 on my Virtual Box and i must say i'm really enjoying using Ubuntu - however at times it can get really laggy and its annoying :-( , was wondering does the lag have something to do with Virtual Box? if so what other Virtual Machine would you recommend :-)
Cheers :-)12 -
Need to ask you all something. Probably a crazy question lol. But I wanna get into Networking. . Plan on taking Network Plus in less than 2 months. Got an interview tomorrow for NOC engineer position . But I currently work in Help Desk Tier 1. Second Shift. This NOC is first shift..... now here's the kicker. I need a second job. Either another full or part. I have 6 years experience at Refrigeration Tech. Which I wanted to leave for IT. I have also a trial day for a Refrigeration company tomorrow as well. First Shift hours as well. So I'm like.... well damn. Do I not go to that job and just hope I get this NOC position . Because Networking is right with where I see myself being1
-
There is a question on StackOverflow, its name is "How do I return the response from an asynchronous call?". I think that everyone knows it. Well, I can easily guess that half of javascript questions on the website are marked as duplicated and linked to this question.
For a moment, let's identify with the people that spend hours on StackOverflow to read all the questions and try to answer to most of them. How stressing and annoying can be repeating the same single thing 50 times a day?
Well, we should take this in account before blaming SO for being rude or before saying that JavaScript sucks without even knowing how to fucking listen to the response on an asynchronous request3 -
We have a prgram at the office that requires me to turn off everyone's antivirus for it to work properly. This has been the case for 2 months while tye software company fixes it. When our computers restart for any reason, the antivirus turns back so I have to turn it off again. I can't give peple the password though because that is the password for a few systems. I get 4 emails today from 4 people that know damn well what the problem is that all say the same thing "I cant figure out why this program wont work. We need to get this fixed or I cant do my job" all with the branch manager CC'd.
Idiots. All of them are damn idiots. 😐🔫 -
Hey guys - I hope everyone is doing very well as always - I'd love to know , on My Ubuntu is it possible to make modifications of my system through Code? - Perhaps i need to download the part I'm interested in making modifications to? any suggestions or recommendations you'd make as to how you would do that? thank you all once again!
Or maybe its not such a good idea for a beginner to be doing such things?
Cheers! <35 -
Spent months writing up a model and fine tuning, trained on complex image data (all we had to work with), to work well with what it needed to do.
Only to have “subject matter experts” be like: why don’t you use PCA and K Nearest Neighbours.
The fuck do you think the baseline was written with? -
I rolled out a feature in one of my previous organizations. It looked awesome. I couldn’t wait to receive all the praises and appreciations but instead was bombarded with bugs and issues. Well, I tested the feature on chrome but little did I know that the users used IE and safari. This is where polyfills in javascript step in. Here I've assembled a list of some important polyfills. Do read it and let me know your opinions.
https://readosapien.com/polyfills-o...1 -
My upright A/C doesn't have both an outside intake and exhaust, just an outside exhaust, so it intakes through the back.
My cat S&D'd right next to the intake while it was on full blast.
just had to evacuate the room and pull the smell out with my grandpa's weird closed-door air purifier thing
(it goes across the entire doorgap at top and bottom and is basically a massive vacuum that sucks everything through an industrial air filter and blows it back into the room cleaner on the other side, looks and works well for being homemade)
on second thought where do all these strange gadgets my family has come from